I wear many hats, but am transitioning my career toward Internet Law. I specialize in the intersection of technology and society, soon to be law to protect civil liberties in the digital domain.
Tags
public policyinformation technologysecurityinformation securityaarons lawcyberlawcfaahactivismwikileaksinformation warfare
I wear many hats, but am transitioning my career toward Internet Law. I specialize in the intersection of technology and society, soon to be law to protect civil liberties in the digital domain.
Tags
public policyinformation technologysecurityinformation securityaarons lawcyberlawcfaahactivismwikileaksinformation warfare
