SlideShare a Scribd company logo
Bioinformatica t3-scoringmatrices v2014
FBW 
13-10-2014 
Wim Van Criekinge
Wel les op 4 november en GEEN les op 18 november
Overview 
• Introduction 
– Short recap on databases 
– Definitions 
• Scoring Matrices 
– Theoretical 
– Empirial 
• PAM (pam-simulator.pl) 
• BLOSUM 
• Pairwise alignment 
– Dot-plots (dotplot-simulator.pl) 
Overview
Major sites 
NCBI - The National Center for Biotechnology Information 
http://www.ncbi.nlm.nih.gov/ 
The National Center for Biotechnology Information (NCBI) at 
the National Library of Medicine (NLM), a part of the National 
Institutes of Health (NIH). 
ExPASy - Molecular Biology Server 
http://expasy.hcuge.ch/www/ 
Molecular biology WWW server of the Swiss Institute of 
Bioinformatics (SIB). This server is dedicated to the analysis of 
protein sequences and structures as well as 2-D PAGE 
EBI - European Bioinformatics Institute 
http://www.ebi.ac.uk/
Anno 2002 Anno 2003
Anno 2004
Anno 2005
Anno 2006
Anno 2007
Anno 2009
Anno 2010 
Anno 2010
Anno 2011
Anno 2012
Anno 2012
Anno 2013
Bioinformatica t3-scoringmatrices v2014
Bioinformatica t3-scoringmatrices v2014
Overview 
• Introduction 
– Short recap on databases 
– Definitions 
• Scoring Matrices 
– Theoretical 
– Empirial 
• PAM (pam-simulator.pl) 
• BLOSUM 
• Pairwise alignment 
– Dot-plots (dotplot-simulator.pl) 
Overview
Definitions 
Identity 
The extent to which two (nucleotide or amino acid) 
sequences are invariant. 
Homology 
Similarity attributed to descent from a common ancestor. 
RBP: 26 RVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWD- 84 
+ K ++ + + GTW++MA+ L + A V T + +L+ W+ 
glycodelin: 23 QTKQDLELPKLAGTWHSMAMA-TNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWEN 81
Definitions 
Orthologous 
Homologous sequences in different species 
that arose from a common ancestral gene 
during speciation; may or may not be responsible 
for a similar function. 
Paralogous 
Homologous sequences within a single species 
that arose by gene duplication.
speciation 
duplication
Multiple sequence alignment of 
glyceraldehyde- 3-phsophate dehydrogenases 
fly GAKKVIISAP SAD.APM..F VCGVNLDAYK PDMKVVSNAS CTTNCLAPLA 
human GAKRVIISAP SAD.APM..F VMGVNHEKYD NSLKIISNAS CTTNCLAPLA 
plant GAKKVIISAP SAD.APM..F VVGVNEHTYQ PNMDIVSNAS CTTNCLAPLA 
bacterium GAKKVVMTGP SKDNTPM..F VKGANFDKY. AGQDIVSNAS CTTNCLAPLA 
yeast GAKKVVITAP SS.TAPM..F VMGVNEEKYT SDLKIVSNAS CTTNCLAPLA 
archaeon GADKVLISAP PKGDEPVKQL VYGVNHDEYD GE.DVVSNAS CTTNSITPVA 
fly KVINDNFEIV EGLMTTVHAT TATQKTVDGP SGKLWRDGRG AAQNIIPAST 
human KVIHDNFGIV EGLMTTVHAI TATQKTVDGP SGKLWRDGRG ALQNIIPAST 
plant KVVHEEFGIL EGLMTTVHAT TATQKTVDGP SMKDWRGGRG ASQNIIPSST 
bacterium KVINDNFGII EGLMTTVHAT TATQKTVDGP SHKDWRGGRG ASQNIIPSST 
yeast KVINDAFGIE EGLMTTVHSL TATQKTVDGP SHKDWRGGRT ASGNIIPSST 
archaeon KVLDEEFGIN AGQLTTVHAY TGSQNLMDGP NGKP.RRRRA AAENIIPTST 
fly GAAKAVGKVI PALNGKLTGM AFRVPTPNVS VVDLTVRLGK GASYDEIKAK 
human GAAKAVGKVI PELNGKLTGM AFRVPTANVS VVDLTCRLEK PAKYDDIKKV 
plant GAAKAVGKVL PELNGKLTGM AFRVPTSNVS VVDLTCRLEK GASYEDVKAA 
bacterium GAAKAVGKVL PELNGKLTGM AFRVPTPNVS VVDLTVRLEK AATYEQIKAA 
yeast GAAKAVGKVL PELQGKLTGM AFRVPTVDVS VVDLTVKLNK ETTYDEIKKV 
archaeon GAAQAATEVL PELEGKLDGM AIRVPVPNGS ITEFVVDLDD DVTESDVNAA
This power of sequence alignments 
• empirical finding: if two biological 
sequences are sufficiently similar, almost 
invariably they have similar biological 
functions and will be descended from a 
common ancestor. 
• (i) function is encoded into sequence, 
this means: the sequence provides the 
syntax and 
• (ii) there is a redundancy in the 
encoding, many positions in the 
sequence may be changed without 
perceptible changes in the function, thus 
the semantics of the encoding is robust.
Overview 
• Introduction 
– Short recap on databases 
– Definitions 
• Scoring Matrices 
– Theoretical 
– Empirial 
• PAM (pam-simulator.pl) 
• BLOSUM 
• Pairwise alignment 
– Dot-plots (dotplot-simulator.pl) 
Overview
A metric … 
It is very important to realize, that all 
subsequent results depend critically on just 
how this is done and what model lies at the 
basis for the construction of a specific 
scoring matrix. 
A scoring matrix is a tool to quantify how 
well a certain model is represented in the 
alignment of two sequences, and any result 
obtained by its application is meaningful 
exclusively in the context of that model.
Importance of scoring matrices 
Scoring matrices appear in all analysis 
involving sequence comparison. 
 The choice of matrix can strongly influence 
the outcome of the analysis. 
 Scoring matrices implicitly represent a 
particular theory of evolution. 
 Understanding theories underlying a given 
scoring matrix can aid in making proper 
choice. 
• Nucleic acid and Protein Scoring Matrices
Nucleic Acid Scoring Matrices 
• Identity matrix (similarity) BLAST matrix (similarity) 
A T C G A T C G 
A 1 0 0 0 A 5 -4 -4 -4 
T 0 1 0 0 T -4 5 -4 -4 
C 0 0 1 0 C -4 -4 5 -4 
G 0 0 0 1 G -4 -4 -4 5 
• Transition/Transversion Matrix 
A T C G 
A 0 5 5 1 
T 5 0 1 5 
C 5 1 0 5 
G 1 5 5 0 
A and T 
purine -pyrimidine 
G and C 
purine-pyrimidine
Transition/Transversion Matrix 
• Nucleotide bases fall into two 
categories depending on the ring 
structure of the base. Purines 
(Adenine and Guanine) are two ring 
bases, pyrimidines (Cytosine and 
Thymine) are single ring bases. 
Mutations in DNA are changes in 
which one base is replaced by 
another. 
• A mutation that conserves the ring 
number is called a transition (e.g., A 
-> G or C -> T) a mutation that 
changes the ring number are called 
transversions. (e.g. A -> C or A -> T 
and so on). 
A T C G 
A 0 5 5 1 
T 5 0 1 5 
C 5 1 0 5 
G 1 5 5 0
Transition/Transversion Matrix 
• Although there are more ways to 
create a transversion, the number 
of transitions observed to occur in 
nature (i.e., when comparing 
related DNA sequences) is much 
greater. Since the likelihood of 
transitions is greater, it is 
sometimes desireable to create a 
weight matrix which takes this 
propensity into account when 
comparing two DNA sequences. 
• Use of a Transition/Transversion 
Matrix reduces noise in 
comparisons of distantly related 
sequences. 
A T C G 
A 0 5 5 1 
T 5 0 1 5 
C 5 1 0 5 
G 1 5 5 0
Protein Scoring Matrices: Unitary Matrix 
• The simplest metric in use is the 
identity metric. 
• If two amino acids are the same, 
they are given one score, if they are 
not, they are given a different score - 
regardless, of what the replacement 
is. 
• One may give a score of 1 for 
matches and 0 for mismatches - this 
leads to the frequently used unitary 
matrix
Protein Scoring Matrices: Unitary Matrix 
A R N D C Q E G H I L K M F P S T W Y V 
A 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 
R 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 
N 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 
D 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 
C 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 
Q 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 
E 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 
G 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 
H 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 
I 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 
L 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 
K 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 
M 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 
F 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 
P 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 
S 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 
T 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 
W 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 
Y 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 
V 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1
Protein Scoring Matrices: Unitary Matrix 
• The simplest matrix: 
– High scores for Identities 
– Low scores for non-identities 
• Works for closely related proteins 
• Or one could assign +6 for a match and -1 for 
a mismatch, this would be a matrix useful for 
local alignment procedures, where a negative 
expectation value for randomly aligned 
sequences is required to ensure that the score 
will not grow simply from extending the 
alignment in a random way.
A very crude model of an evolutionary 
relationship could be implemented in a 
scoring matrix in the following way: since 
all point-mutations arise from nucleotide 
changes, the probability that an observed 
amino acid pair is related by chance, 
rather than inheritance should depend on 
the number of point mutations necessary 
to transform one codon into the other. 
A metric resulting from this model would 
define the distance between two amino 
acids by the minimal number of nucleotide 
changes required. 
Genetic Code Matrix
Genetic Code Matrix 
The table is generated by calculating the minimum number of base changes required to 
convert an amino acid in row i to an amino acid in column j. 
Note Met->Tyr is the only change that requires all 3 codon positions to change. 
A S G L K V T P E D N I Q R F Y C H M W Z B X 
Ala = A O 1 1 2 2 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 
Ser = S 1 O 1 1 2 2 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 2 
Gly = G 1 1 0 2 2 1 2 2 1 1 2 2 2 1 2 2 1 2 2 1 2 2 2 
Leu = L 2 1 2 0 2 1 2 1 2 2 2 1 1 1 1 2 2 1 1 1 2 2 2 
Lys = K 2 2 2 2 0 2 1 2 1 2 1 1 1 1 2 2 2 2 1 2 1 2 2 
Val = V 1 2 1 1 2 0 2 2 1 1 2 1 2 2 1 2 2 2 1 2 2 2 2 
Thr = T 1 1 2 2 1 2 0 1 2 2 1 1 2 1 2 2 2 2 1 2 2 2 2 
Pro = P 1 1 2 1 2 2 1 0 2 2 2 2 1 1 2 2 2 1 2 2 2 2 2 
Glu - E 1 2 1 2 1 1 2 2 0 1 2 2 1 2 2 2 2 2 2 2 1 2 2 
Asp = D 1 2 1 2 2 1 2 2 1 O 1 2 2 2 2 1 2 1 2 2 2 1 2 
Asn = N 2 1 2 2 1 2 1 2 2 1 O 1 2 2 2 1 2 1 2 2 2 1 2 
Ile = I 2 1 2 1 1 1 1 2 2 2 1 0 2 1 1 2 2 2 1 2 2 2 2 
Gln = Q 2 2 2 1 1 2 2 1 1 2 2 2 0 1 2 2 2 1 2 2 1 2 2 
Arg = R 2 1 1 1 1 2 1 1 2 2 2 1 1 0 2 2 1 1 1 1 2 2 2 
Phe = F 2 1 2 1 2 1 2 2 2 2 2 1 2 2 0 1 1 2 2 2 2 2 2 
Tyr = Y 2 1 2 2 2 2 2 2 2 1 1 2 2 2 1 O 1 1 3 2 2 1 2 
Cys = C 2 1 1 2 2 2 2 2 2 2 2 2 2 1 1 1 0 2 2 1 2 2 2 
His = H 2 2 2 1 2 2 2 1 2 1 1 2 1 1 2 1 2 0 2 2 2 1 2 
Met = M 2 2 2 1 1 1 1 2 2 2 2 1 2 1 2 3 2 2 0 2 2 2 2 
Trp = W 2 1 1 1 2 2 2 2 2 2 2 2 2 1 2 2 1 2 2 0 2 2 2 
Glx = Z 2 2 2 2 1 2 2 2 1 2 2 2 1 2 2 2 2 2 2 2 1 2 2 
Asx = B 2 2 2 2 2 2 2 2 2 1 1 2 2 2 2 1 2 1 2 2 2 1 2 
??? = X 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2
This genetic code matrix already 
improves sensitivity and specificity 
of alignments from the identity 
matrix. 
The fact that the genetic code matrix 
works to align related proteins, in 
the same way that matrices derived 
from amino-acid properties work 
says something very interesting 
about the genetic code: namely that 
it appears to have evolved to 
minimize the effects of point 
mutations. 
Genetic Code Matrix
Genetic Code Matrix
• Simple identity, which scores only identical amino 
acids as a match. 
• Genetic code changes, which scores the 
minimum number of nucieotide changes to change 
a codon for one amino acid into a codon for the 
other. 
• Chemical similarity of amino acid side chains, 
which scores as a match two amino acids which 
have a similar side chain, such as hydrophobic, 
charged and polar amino acid groups. 
Overview
All proteins are polymers of the 20 naturally occuring 
amino acids. They are listed here along with their 
abbreviations :- 
Alanine Ala A 
Cysteine Cys C 
Aspartic AciD Asp D 
Glutamic Acid Glu E 
Phenylalanine Phe F 
Glycine Gly G 
Histidine His H 
Isoleucine Ile I 
Lysine Lys K 
Leucine Leu L 
Methionine Met M 
AsparagiNe Asn N 
Proline Pro P 
Glutamine Gln Q 
ARginine Arg R 
Serine Ser S 
Threonine Thr T 
Valine Val V 
Tryptophan Trp W 
TYrosine Tyr Y 
Amino Acid Residues
All amino acids have the 
same general formula 
Amino Acid Residues
• Hydrophobic-aliphatic amino 
acids: Their side chains consist of 
non-polar methyl- or methylene-groups. 
– These amino acids are usually located 
on the interior of the protein as they 
are hydrophobic in nature. 
– All except for alanine are bifurcated. In 
the cases of Val and Ile the bifurcation 
is close to the main chain and can 
therefore restrict the conformation of 
the polypeptide by steric hindrance. 
– red and blue atoms represent polar 
main chain groups 
Amino Acid Residues
Amino Acid Residues
• Hydrophobic-aromatic: Only 
phenylalanine is entirely non-polar. 
Tyrosine's phenolic side chain has a 
hydroxyl substituent and tryptophan 
has a nitrogen atom in its indole ring 
sytem. 
– These residues are nearly always found 
to be largely buried in the hydrophobic 
interior of a proteins as they are 
prdeominantly non-polar in nature. 
– However, the polar atoms of tyrosine 
and tryptophan allow hydrogen bonding 
interactions to be made with other 
residues or even solvent molecules 
Amino Acid Residues
Amino Acid Residues
Neutral-polar side chains: a number of 
small aliphatic side chains containing polar 
groups which cannot ionize readily. 
– Serine and threonine possess hydroxyl groups in 
their side chains and as these polar groups are 
close to the main chain they can form hydrogen 
bonds with it. This can influence the local 
conformation of the polypeptide, 
– Residues such as serine and asparagine are 
known to adopt conformations which most other 
amino acids cannot. 
– The amino acids asparagine and glutamine 
posses amide groups in their side chains which 
are usually hydrogen-bonded whenever they 
occur in the interior of a protein. 
Amino Acid Residues
Amino Acid Residues
• Acidic amino acids: Aspartate and 
glutamate have carboxyl side chains 
and are therefore negatively charged 
at physiological pH (around neutral). 
– The strongly polar nature of these 
residues means that they are most often 
found on the surface of globular proteins 
where they can interact favourably with 
solvent molecules. 
– These residues can also take part in 
electrostatic interactions with positively 
charged basic amino acids. 
– Aspartate and glutamate also can take 
on catalytic roles in the active sites of 
enzymes and are well known for their 
metal ion binding abilities 
Amino Acid Residues
Amino Acid Residues
• Basic amino acids: 
– histidine has the lowest pKa (around 6) and is 
therefore neutral at around physiological pH. 
• This amino acid occurs very frequently in enzyme 
active sites as it can function as a very efficient 
general acid-base catalyst. 
• It also acts as a metal ion ligand in numerous 
protein families. 
– Lysine and arginine are more strongly basic and 
are positively charged at physiological pH's. They 
are generally solvated but do occasionally occur 
in the interior of a protein where they are usually 
involved in electrostatic interactions with 
negatively charged groups such as Asp or Glu. 
• Lys and Arg have important roles in anion-binding 
proteins as they can interact electrostatically with 
the ligand. 
Amino Acid Residues
Amino Acid Residues
Conformationally important residues: Glycine and 
proline are unique amino acids. They appear to 
influence the conformation of the polypeptide. 
• Glycine essentially lacks a side chain and therefore 
can adopt conformations which are sterically 
forbidden for other amino acids. This confers a high 
degree of local flexibility on the polypeptide. 
– Accordingly, glycine residues are frequently found in 
turn regions of proteins where the backbone has to 
make a sharp turn. 
– Glycine occurs abundantly in certain fibrous proteins 
due to its flexibility and because its small size allows 
adjacent polypeptide chains to pack together closely. 
• In contrast, proline is the most rigid of the twenty 
naturally occurring amino acids since its side chain 
is covalently linked with the main chain nitrogen 
Amino Acid Residues
Amino Acid Residues
Here is one list where amino acids are 
grouped according to the characteristics of 
the side chains: 
 Aliphatic - alanine, glycine, isoleucine, 
leucine, proline, valine, 
 Aromatic - phenylalanine, tryptophan, 
tyrosine, 
 Acidic - aspartic acid, glutamic acid, 
 Basic - arginine, histidine, lysine, 
 Hydroxylic - serine, threonine 
 Sulphur-containing - cysteine, 
methionine 
 Amidic (containing amide group) - 
asparagine, glutamine 
Amino Acid Residues
Hydrophobicity matrix 
R K D E B Z S N Q G X T H A C M P V L I Y F W 
Arg = R 10 10 9 9 8 8 6 6 6 5 5 5 5 5 4 3 3 3 3 3 2 1 0 
Lys = K 10 10 9 9 8 8 6 6 6 5 5 5 5 5 4 3 3 3 3 3 2 1 0 
Asp = D 9 9 10 10 8 8 7 6 6 6 5 5 5 5 5 4 4 4 3 3 3 2 1 
Glu = E 9 9 10 10 8 8 7 6 6 6 5 5 5 5 5 4 4 4 3 3 3 2 1 
Asx = B 8 8 8 8 10 10 8 8 8 8 7 7 7 7 6 6 6 5 5 5 4 4 3 
Glx = Z 8 8 8 8 10 10 8 8 8 8 7 7 7 7 6 6 6 5 5 5 4 4 3 
Ser = S 6 6 7 7 8 8 10 10 10 10 9 9 9 9 8 8 7 7 7 7 6 6 4 
Asn = N 6 6 6 6 8 8 10 10 10 10 9 9 9 9 8 8 8 7 7 7 6 6 4 
Gln = Q 6 6 6 6 8 8 10 10 10 10 9 9 9 9 8 8 8 7 7 7 6 6 4 
Gly = G 5 5 6 6 8 8 10 10 10 10 9 9 9 9 8 8 8 8 7 7 6 6 5 
??? = X 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 8 8 8 8 7 7 5 
Thr = T 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 8 8 8 8 7 7 5 
His = H 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 9 8 8 8 7 7 5 
Ala = A 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 9 8 8 8 7 7 5 
Cys = C 4 4 5 5 6 6 8 8 8 8 9 9 9 9 10 10 9 9 9 9 8 8 5 
Met = M 3 3 4 4 6 6 8 8 8 8 9 9 9 9 10 10 10 10 9 9 8 8 7 
Pro = P 3 3 4 4 6 6 7 8 8 8 8 8 9 9 9 10 10 10 9 9 9 8 7 
Val = V 3 3 4 4 5 5 7 7 7 8 8 8 8 8 9 10 10 10 10 10 9 8 7 
Leu = L 3 3 3 3 5 5 7 7 7 7 8 8 8 8 9 9 9 10 10 10 9 9 8 
Ile = I 3 3 3 3 5 5 7 7 7 7 8 8 8 8 9 9 9 10 10 10 9 9 8 
Tyr = Y 2 2 3 3 4 4 6 6 6 6 7 7 7 7 8 8 9 9 9 9 10 10 8 
Phe = F 1 1 2 2 4 4 6 6 6 6 7 7 7 7 8 8 8 8 9 9 10 10 9 
Trp = W 0 0 1 1 3 3 4 4 4 5 5 5 5 5 6 7 7 7 8 8 8 9 10 
•Physical/Chemical characteristics: Attempt to quantify some physical or chemical attribute of 
•the residues and arbitrarily assign weights based on similarities of the residues in this chosen property.
Other similarity scoring matrices might be constructed from 
any property of amino acids that can be quantified 
- partition coefficients between hydrophobic and hydrophilic phases 
- charge 
- molecular volume 
Unfortunately, …
AAindex 
Amino acid indices and similarity matrices 
(http://www.genome.ad.jp/dbget/aaindex.html) 
List of 494 Amino Acid Indices in AAindex ver.6.0 
• ANDN920101 alpha-CH chemical shifts (Andersen et al., 1992) 
• ARGP820101 Hydrophobicity index (Argos et al., 1982) 
• ARGP820102 Signal sequence helical potential (Argos et al., 1982) 
• ARGP820103 Membrane-buried preference parameters (Argos et al., 1982) 
• BEGF750101 Conformational parameter of inner helix (Beghin-Dirkx, 1975) 
• BEGF750102 Conformational parameter of beta-structure (Beghin-Dirkx, 1975) 
• BEGF750103 Conformational parameter of beta-turn (Beghin-Dirkx, 1975) 
• BHAR880101 Average flexibility indices (Bhaskaran-Ponnuswamy, 1988) 
• BIGC670101 Residue volume (Bigelow, 1967) 
• BIOV880101 Information value for accessibility; average fraction 35% (Biou et al., 1988) 
• BIOV880102 Information value for accessibility; average fraction 23% (Biou et al., 1988) 
• BROC820101 Retention coefficient in TFA (Browne et al., 1982) 
• BROC820102 Retention coefficient in HFBA (Browne et al., 1982) 
• BULH740101 Transfer free energy to surface (Bull-Breese, 1974) 
• BULH740102 Apparent partial specific volume (Bull-Breese, 1974)
Protein Eng. 1996 Jan;9(1):27-36.
• Simple identity, which scores only identical amino 
acids as a match. 
• Genetic code changes, which scores the 
minimum number of nucieotide changes to change 
a codon for one amino acid into a codon for the 
other. 
• Chemical similarity of amino acid side chains, 
which scores as a match two amino acids which 
have a similar side chain, such as hydrophobic, 
charged and polar amino acid groups. 
• The Dayhoff percent accepted mutation (PAM) 
family of matrices, which scores amino acid pairs 
on the basis of the expected frequency of 
substitution of one amino acid for the other during 
protein evolution. 
Overview
• In the absence of a valid model 
derived from first principles, an 
empirical approach 
seems more appropriate to score 
amino acid similarity. 
• This approach is based on 
the assumption that once the 
evolutionary relationship of two 
sequences is 
established, the residues that did 
exchange are similar. 
Dayhoff Matrix
Model of Evolution: 
“Proteins evolve through a succesion of 
independent point mutations, that are 
accepted in a population and 
subsequently can be observed in the 
sequence pool.” 
Definition: 
The evolutionary distance between two 
sequences is the (minimal) number of 
point mutations that was necessary to 
evolve one sequence into the other 
Overview
• The model used here states that 
proteins evolve through a succesion of 
independent point mutations, that are 
accepted in a population and 
subsequently can be observed in the 
sequence pool. 
• We can define an evolutionary 
distance between two sequences as 
the number of point mutations that was 
necessary to evolve one sequence into 
the other. 
Principle
• M.O. Dayhoff and colleagues 
introduced the term "accepted point 
mutation" for a mutation that is stably 
fixed in the gene pool in the course 
of evolution. Thus a measure of 
evolutionary distance between two 
sequences can be defined: 
• A PAM (Percent accepted mutation) 
is one accepted point mutation on 
the path between two sequences, 
per 100 residues. 
Overview
Principles of Scoring Matrix Construction 
First step: finding “accepted mutations” 
In order to identify accepted point 
mutations, a complete phylogenetic 
tree including all ancestral sequences 
has to be constructed. To avoid a 
large degree of ambiguities in this 
step, Dayhoff and colleagues 
restricted their analysis to sequence 
families with more than 85% identity.
Identification of accepted point mutations: 
•Collection of correct (manual) alignments 
• 1300 sequences in 72 families 
• closely related in order not to get multiply 
changes at the same position 
• Construct a complete phylogenetic tree including all 
ancestral sequences. 
• Dayhoff et al restricted their analysis to 
sequence families with more than 85% 
identity. 
• Tabulate into a 20x20 matrix the amino acid pair 
exchanges for each of the observed and inferred 
sequences. 
Overview
ACGH DBGH ADIJ CBIJ 
 /  / 
 /  / 
B - C  / A - D B - D  / A - C 
 /  / 
/ / 
ABGH ABIJ 
 / 
 I - G / 
 J - H / 
 / 
 / 
| 
| 
| 
Overview
Dayhoff’s PAM1 mutation probability matrix (Transition Matrix) 
A 
Ala 
R 
Arg 
N 
Asn 
D 
Asp 
C 
Cys 
Q 
Gln 
E 
Glu 
G 
Gly 
H 
His 
I 
Ile 
A 9867 2 9 10 3 8 17 21 2 6 
R 1 9913 1 0 1 10 0 0 10 3 
N 4 1 9822 36 0 4 6 6 21 3 
D 6 0 42 9859 0 6 53 6 4 1 
C 1 1 0 0 9973 0 0 0 1 1 
Q 3 9 4 5 0 9876 27 1 23 1 
E 10 0 7 56 0 35 9865 4 2 3 
G 21 1 12 11 1 3 7 9935 1 0 
H 1 8 18 3 1 20 1 0 9912 0 
I 2 2 3 1 2 1 2 0 0 9872
PAM1: Transition Matrix 
Ala Arg Asn Asp Cys Gln Glu Gly His Ile Leu Lys Met 
Phe Pro Ser Thr Trp Tyr Val 
A R N D C Q E G H I L K M F P S T W Y V 
Ala A 9867 2 9 10 3 8 17 21 2 6 4 2 6 2 22 35 32 0 2 18 
Arg R 1 9913 1 0 1 10 0 0 10 3 1 19 4 1 4 6 1 8 0 1 
Asn N 4 1 9822 36 0 4 6 6 21 3 1 13 0 1 2 20 9 1 4 1 
Asp D 6 0 42 9859 0 6 53 6 4 1 0 3 0 0 1 5 3 0 0 1 
Cys C 1 1 0 0 9973 0 0 0 1 1 0 0 0 0 1 5 1 0 3 2 
Gln Q 3 9 4 5 0 9876 27 1 23 1 3 6 4 0 6 2 2 0 0 1 
Glu E 10 0 7 56 0 35 9865 4 2 3 1 4 1 0 3 4 2 0 1 2 
Gly G 21 1 12 11 1 3 7 9935 1 0 1 2 1 1 3 21 3 0 0 5 
His H 1 8 18 3 1 20 1 0 9912 0 1 1 0 2 3 1 1 1 4 1 
Ile I 2 2 3 1 2 1 2 0 0 9872 9 2 12 7 0 1 7 0 1 33 
Leu L 3 1 3 0 0 6 1 1 4 22 9947 2 45 13 3 1 3 4 2 15 
Lys K 2 37 25 6 0 12 7 2 2 4 1 9926 20 0 3 8 11 0 1 1 
Met M 1 1 0 0 0 2 0 0 0 5 8 4 9874 1 0 1 2 0 0 4 
Phe F 1 1 1 0 0 0 0 1 2 8 6 0 4 9946 0 2 1 3 28 0 
Pro P 13 5 2 1 1 8 3 2 5 1 2 2 1 1 9926 12 4 0 0 2 
Ser S 28 11 34 7 11 4 6 16 2 2 1 7 4 3 17 9840 38 5 2 2 
Thr T 22 2 13 4 1 3 2 2 1 11 2 8 6 1 5 32 9871 0 2 9 
Trp W 0 2 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 9976 1 0 
Tyr Y 1 0 3 0 3 0 1 0 4 1 1 0 0 21 0 1 1 2 9945 1 
Val V 13 2 1 1 3 2 2 3 3 57 11 1 17 1 3 2 10 0 2 9901
Numbers of accepted point mutations (x10) 
accumulated from closely related 
sequences. 
Fractional exchanges result when ancestral 
sequences are ambiguous: the 
probabilities are distributed equally 
among all possibilities. 
The total number of exchanges tallied was 
1,572. Note that 36 exchanges were 
never observed. 
The Asp-Glu pair had the largest number of 
exchanges 
PAM1: Transition Matrix
Principles of Scoring Matrix Construction 
Second step: Frequencies of Occurence 
If the properties of amino acids differ and if 
they occur with different frequencies, all 
statements we can make about the average 
properties of sequences will depend on the 
frequencies of occurence of the individual 
amino acids. These frequencies of 
occurence are approximated by the 
frequencies of observation. They are the 
number of occurences of a given amino acid 
divided by the number of amino-acids 
observed. 
The sum of all is one.
Amino acid frequencies 
Second step: Frequencies of Occurence 
1978 1991 
L 0.085 0.091 
A 0.087 0.077 
G 0.089 0.074 
S 0.070 0.069 
V 0.065 0.066 
E 0.050 0.062 
T 0.058 0.059 
K 0.081 0.059 
I 0.037 0.053 
D 0.047 0.052 
R 0.041 0.051 
P 0.051 0.051 
N 0.040 0.043 
Q 0.038 0.041 
F 0.040 0.040 
Y 0.030 0.032 
M 0.015 0.024 
H 0.034 0.023 
C 0.033 0.020 
W 0.010 0.014
Principles of Scoring Matrix Construction 
Third step: Relative Mutabilities 
• To obtain a complete picture of the 
mutational process, the amino-acids that 
do not mutate must be taken into account 
too. 
• We need to know: what is the chance, on 
average, that a given amino acid will 
mutate at all. This is the relative 
mutability of the amino acid. 
• It is obtained by multiplying the number 
of observed changes by the amino acids 
frequency of occurence.
Compute amino acid mutability, mj, i.e., the propability 
of a given amino acid, j, to be replaced. 
Aligned A D A 
Sequences A D B 
Amino Acids A B D 
Observed Changes 1 1 0 
Frequency of Occurence 3 1 2 
(Total Composition) 
Relative Mutability .33 1 0 
Overview
Principles of Scoring Matrix Construction 
1978 1991 
A 100 100 
C 20 44 
D 106 86 
E 102 77 
F 41 51 
G 49 50 
H 66 91 
I 96 103 
K 56 72 
L 40 54 
M 94 93 
N 134 104 
P 56 58 
Q 93 84 
R 65 83 
S 120 117 
T 97 107 
V 74 98 
W 18 25 
Y 41 50
Principles of Scoring Matrix Construction 
Fourth step: Mutation Probability Matrix 
• With these data the probability that an amino acid in 
row i of the matrix will replace the amino acid in 
column j can be calculated: it is the mutability of amino 
acid j, multiplied by the relative pair exchange 
frequency (the pair exchange frequency for ij divided 
by the sum of all pair exchange frequencies for amino 
acid i). 
Mij= The mutation probability matrix gives the 
probability, that an amino acid i will replace an amino 
acid of type j in a given evolutionary interval, in two 
related sequences 
ADB 
ADA 
A D B 
A 
D 
B 
i 
j
Principles of Scoring Matrix Construction 
Fifth step: The Evolutionary Distance 
• Since the represent the probabilites 
for amino acids to remain 
conserved, if we scale all cells of our 
matrix by a constant factor we can 
scale the matrix to reflect a specific 
overall probability of change. We 
may chose so that the expected 
number of changes is 1 %, this 
gives the matrix for the evolutionary 
distance of 1 PAM.
Principles of Scoring Matrix Construction 
6. Relatedness Odds 
• By comparison, the probability that 
that same event is observed by 
random chance is simply given by 
the frequency of occurence of 
amino acid i 
• Rij = probability that j replaces i in 
related proteins 
ran = probability that j replaces I by 
chance (eg unrelated proteins) 
• Pi 
ran = fi = the frequency of 
occurance of amino acid i 
• Pi
Principles of Scoring Matrix Construction 
Last step: the log-odds matrix 
• Since multiplication is a computationally 
expensive process, it is preferrable to add 
the logarithms of the matrix elements. This 
matrix, the log odds matrix, is the 
foundation of quantitative sequence 
comparisons under an evolutionary model. 
• Since the Dayhoff matrix was taken as the 
log to base 10, a value of +1 would mean 
that the corresponding pair has been 
observed 10 times more frequently than 
expected by chance. A value of -0.2 would 
mean that the observed pair was observed 
1.6 times less frequently than chance 
would predict.
• http://www.bio.brandeis.edu/InterpGenes/Proj 
ect/align12.htm
A B C D E F G H I K L M N P Q R S T V W Y Z 
0.4 0.0 -0.4 0.0 0.0 -0.8 0.2 -0.2 -0.2 -0.2 -0.4 -0.2 0.0 0.2 0.0 -0.4 0.2 0.2 0.0 -1.2 -0.6 0.0 A 
0.5 -0.9 0.6 0.4 -1.0 0.1 0.3 -0.4 0.1 -0.7 -0.5 0.4 -0.2 0.3 -0.1 0.1 0.0 -0.4 -1.1 -0.6 0.4 B 
2.4 -1.0 -1.0 -0.8 -0.6 -0.6 -0.4 -1.0 -1.2 -1.0 -0.8 -0.6 -1.0 -0.8 0.0 -0.4 -0.4 -1.6 0.0 -1.0 C 
0.8 0.6 -1.2 0.2 0.2 -0.4 0.0 -0.8 -0.6 0.4 -0.2 0.4 -0.2 0.0 0.0 -0.4 -1.4 -0.8 0.5 D 
0.8 -1.0 0.0 0.2 -0.4 0.0 -0.6 -0.4 0.2 -0.2 0.4 -0.2 0.0 0.0 -0.4 -1.4 -0.8 0.6 E 
1.8 -1.0 -0.4 0.2 -1.0 0.4 0.0 -0.8 -1.0 -1.0 -0.8 -0.6 -0.6 -0.2 0.0 1.4 -1.0 F 
1.0 -0.4 -0.6 -0.4 -0.8 -0.6 0.0 -0.2 -0.2 -0.6 0.2 0.0 -0.2 -1.4 -1.0 -0.1 G 
1.2 -0.4 0.0 -0.4 -0.4 0.4 0.0 0.6 0.4 -0.2 -0.2 -0.4 -0.6 0.0 -0.4 H 
1.0 -0.4 0.4 0.4 -0.4 -0.4 -0.4 -0.4 -0.2 0.0 0.8 -1.0 -0.2 -0.4 I 
1.0 -0.6 0.0 0.2 -0.2 0.2 0.6 0.0 0.0 -0.4 -0.6 -0.8 0.1 K 
1.2 0.8 -0.6 -0.6 -0.4 -0.6 -0.6 -0.4 0.4 -0.4 -0.2 -0.5 L 
1.2 -0.4 -0.4 -0.2 0.0 -0.4 -0.2 0.4 -0.8 -0.4 -0.3 M 
0.4 -0.2 0.2 0.0 0.2 0.0 -0.4 -0.8 -0.4 0.2 N 
1.2 0.0 0.0 0.2 0.0 -0.2 -1.2 -1.0 -0.1 P 
0.8 0.2 -0.2 -0.2 -0.4 -1.0 -0.8 0.6 Q 
1.2 0.0 -0.2 -0.4 0.4 -0.8 0.6 R 
0.4 0.2 -0.2 -0.4 -0.6 -0.1 S 
0.6 0.0 -1.0 -0.6 -0.1 T 
0.8 -1.2 -0.4 -0.4 V 
3.4 0.0 -1.2 W 
2.0 -0.8 Y 
0.6 Z 
PAM 1 Scoring Matrix
• Some of the properties go into the 
makeup of PAM matrices are - amino 
acid residue size, shape, local 
concentrations of electric charge, van 
der Waals surface, ability to form salt 
bridges, hydrophobic interactions, and 
hydrogen bonds. 
– These patterns are imposed principally 
by natural selection and only secondarily 
by the constraints of the genetic code. 
– Coming up with one’s own matrix of 
weights based on some logical features 
may not be very successful because your 
logical features may have been over-written 
by other more important 
considerations. 
Overview
Principles of Scoring Matrix Construction 
• Two aspects of this process cause the 
evolutionary distance to be unequal in 
general to the number of observed 
differences between the sequences: 
– First, there is a chance that a certain 
residue may have mutated, than reverted, 
hiding the effect of the mutation. 
– Second, specific residues may have 
mutated more than once, thus the number 
of point mutations is likely to be larger 
than the number of differences between 
the two sequences..
Similarity ve. distance
Experiment: pam-simulator.pl 
• Initialize: 
– Generate Random protein (1000 aa) 
• Simulate evolution (eg 250 for PAM250) 
– Apply PAM1 Transition matrix to each amino 
acid 
– Use Weighted Random Selection 
• Iterate 
– Measure difference to orginal protein
Dayhoff’s PAM1 mutation probability matrix (Transition Matrix) 
A 
Ala 
R 
Arg 
N 
Asn 
D 
Asp 
C 
Cys 
Q 
Gln 
E 
Glu 
G 
Gly 
H 
His 
I 
Ile 
A 9867 2 9 10 3 8 17 21 2 6 
R 1 9913 1 0 1 10 0 0 10 3 
N 4 1 9822 36 0 4 6 6 21 3 
D 6 0 42 9859 0 6 53 6 4 1 
C 1 1 0 0 9973 0 0 0 1 1 
Q 3 9 4 5 0 9876 27 1 23 1 
E 10 0 7 56 0 35 9865 4 2 3 
G 21 1 12 11 1 3 7 9935 1 0 
H 1 8 18 3 1 20 1 0 9912 0 
I 2 2 3 1 2 1 2 0 0 9872
Weighted Random Selection 
• Ala => Xxx (%) 
A 
R 
N 
D 
C 
Q 
E 
G 
H 
I 
L 
K 
M 
F 
P 
S 
T 
W 
Y 
V
PAM-Simulator 
PAM-simulator 
120 
100 
80 
60 
40 
20 
0 
0 50 100 150 200 250 300 
PAM 
%identity
PAM-Simulator 
PAM-Simulator 
100 
90 
80 
70 
60 
50 
40 
30 
20 
10 
0 
0 200 400 600 800 1000 1200 1400 1600 1800 2000 
PAM 
% identity
Some PAM values and their corresponding observed distances 
PAM Value Distance(%) 
80 50 
100 60 
200 75 
250 85 <- Twilight zone 
300 92 
(From Doolittle, 1987, Of URFs and ORFs, 
University Science Books) 
•When the PAM distance value between two distantly related proteins nears the value 250 it 
becomes difficult to tell whether the two proteins are homologous, or that they are two at 
randomly taken proteins that can be aligned by chance. In that case we speak of the 'twilight 
zone'. 
•The relation between the observed percentage in distance of two sequences versus PAM 
value. Two randomly diverging sequences change in a negatively exponential fashion. After 
the insertion of gaps to two random sequences, it can be expected that they will be 80 - 90 % 
dissimilar (from Doolittle, 1987 ).
• Creation of a pam series from evolutionary 
simulations 
• pam2=pam1^2 
• pam3=pam1^3 
• And so on… 
• pam30,60,90,120,250,300 
• low pam - closely related sequences 
– high scores for identity and low scores for 
substitutions - closer to the identity matrix 
• high pam - distant sequences 
– at pam2000 all information is degenerate except 
for cysteins 
• pam250 is the most popular and general 
– one amino acid in five remains unchanged 
(mutability varies among the amino acids) 
Overview
Bioinformatica t3-scoringmatrices v2014
Overview 
250 PAM evolutionary distance 
A R N D C Q E G H I L K M F P 
Ala A 13 6 9 9 5 8 9 12 6 8 6 7 7 4 11 
Arg R 3 17 4 3 2 5 3 2 6 3 2 9 4 1 4 
Asn N 4 4 6 7 2 5 6 4 6 3 2 5 3 2 4 
Asp D 5 4 8 11 1 7 10 5 6 3 2 5 3 1 4 
Cys C 2 1 1 1 52 1 1 2 2 2 1 1 1 1 2 
Gln Q 3 5 5 6 1 10 7 3 7 2 3 5 3 1 4 
Glu E 5 4 7 11 1 9 12 5 6 3 2 5 3 1 4 
Gly G 12 5 10 10 4 7 9 27 5 5 4 6 5 3 8 
His H 2 5 5 4 2 7 4 2 15 2 2 3 2 2 3 
Ile I 3 2 2 2 2 2 2 2 2 10 6 2 6 5 2 
Leu L 6 4 4 3 2 6 4 3 5 15 34 4 20 13 5 
Lys K 6 18 10 8 2 10 8 5 8 5 4 24 9 2 6 
Met M 1 1 1 1 0 1 1 1 1 2 3 2 6 2 1 
Phe F 2 1 2 1 1 1 1 1 3 5 6 1 4 32 1 
Pro P 7 5 5 4 3 5 4 5 5 3 3 4 3 2 20 
Ser S 9 6 8 7 7 6 7 9 6 5 4 7 5 3 9 
Thr T 8 5 6 6 4 5 5 6 4 6 4 6 5 3 6 
Trp W 0 2 0 0 0 0 0 0 1 0 1 0 0 1 0 
Tyr Y 1 1 2 1 3 1 1 1 3 2 2 1 2 15 1 
Val V 7 4 4 4 4 4 4 4 5 4 15 10 4 10 5 
[column on left represents the replacement amino acid] 
Mutation probability matrix for the evolutionary distance of 250 PAMs. To 
simplify the appearance, the elements are shown multiplied by 100. 
In comparing two sequences of average amino acid frequency at this 
evolutionary distance, there is a 13% probability that a position 
containing Ala in the first sequence will contain Ala in the second. 
There is a 3% chance that it will contain Arg, and so forth.
A brief history of time (BYA) 
Origin of 
life 
Origin of 
eukaryotes insects 
Fungi/animal 
Plant/animal 
Earliest 
fossils 
4 3 2 1 0 
BYA
Margaret Dayhoff’s 34 protein superfamilies 
Protein PAMs per 100 million years 
Ig kappa chain 37 
Kappa casein 33 
Lactalbumin 27 
Hemoglobin a 12 
Myoglobin 8.9 
Insulin 4.4 
Histone H4 0.10 
Ubiquitin 0.00
 Many sequences depart from average 
composition. 
 Rare replacements were observed too 
infrequently to resolve relative 
probabilities accurately (for 36 pairs no 
replacements were observed!). 
 Errors in 1PAM are magnified in the 
extrapolation to 250PAM. 
 Distantly related sequences usually 
have islands (blocks) of conserved 
residues. This implies that replacement 
is not equally probable over entire 
sequence. 
Sources of error
• Simple identity, which scores only identical amino 
acids as a match. 
• Genetic code changes, which scores the 
minimum number of nucieotide changes to change 
a codon for one amino acid into a codon for the 
other. 
• Chemical similarity of amino acid side chains, 
which scores as a match two amino acids which 
have a similar side chain, such as hydrophobic, 
charged and polar amino acid groups. 
• The Dayhoff percent accepted mutation (PAM) 
family of matrices, which scores amino acid pairs 
on the basis of the expected frequency of 
substitution of one amino acid for the other during 
protein evolution. 
• The blocks substitution matrix (BLOSUM) amino 
acid substitution tables, which scores amino acid 
pairs based on the frequency of amino acid 
substitutions in aligned sequence motifs called 
blocks which are found in protein families 
Overview
BLOSUM: Blocks Substitution Matrix 
• Henikoff & Henikoff (Henikoff, S. & 
Henikoff J.G. (1992) PNAS 89:10915- 
10919) 
• asking about the relatedness of distantly 
related amino acid sequences ? 
• They use blocks of sequence fragments 
from different protein families which can 
be aligned without the introduction of 
gaps. These sequence blocks correspond 
to the more highly conserved regions.
BLOSUM (BLOck – SUM) scoring 
S = 3 sequences 
W = 6 aa 
N= (W*S*(S-1))/2 = 18 pairs 
DDNAAV 
DNAVDD 
NNVAVV 
Block = ungapped alignent 
Eg. Amino Acids D N V A 
a b c d e f 
1 
2 
3
A. Observed pairs 
a b c d e f 
DDNAAV 
DNAVDD 
NNVAVV 
1 
2 
3 
D N A V 
D 
N 
A 
V 
1 
4 
1 
3 
1 
1 
1 
1 
4 1 
f fij 
D N A V 
D 
N 
A 
V 
.056 
.222 
.056 
.167 
.056 
.056 
.056 
.056 
.222 .056 
gij 
/18 
Relative frequency table 
Probability of obtaining a pair 
if randomly choosing pairs 
from block
B. Expected pairs A 
DDDDD 
NNNN 
AAAA 
VVVVV 
DDNAAV 
DNAVDD 
NNVAVV 
Pi 
5/18 
4/18 
4/18 
5/18 
P{Draw DN pair}= P{Draw D, then N or Draw M, then D} 
P{Draw DN pair}= PDPN + PNPD = 2 * (5/18)*(4/18) = .123 
D N A V 
D 
N 
A 
V 
.077 
.123 
.154 
.123 
.049 
.123 
.099 
.049 
.123 .049 
eRandom rel. frequency table ij 
Probability of obtaining a pair of 
each amino acid drawn 
independently from block
C. Summary (A/B) 
sij = log2 gij/eij 
(sij) is basic BLOSUM score matrix 
Notes: 
• Observed pairs in blocks contain information about 
relationships at all levels of evolutionary distance 
simultaneously (Cf: Dayhoffs’s close relationships) 
• Actual algorithm generates observed + expected pair 
distributions by accumalution over a set of approx. 2000 
ungapped blocks of varrying with (w) + depth (s)
• blosum30,35,40,45,50,55,60,62,65,70,75,80,85,90 
• transition frequencies observed directly by identifying 
blocks that are at least 
– 45% identical (BLOSUM45) 
– 50% identical (BLOSUM50) 
– 62% identical (BLOSUM62) etc. 
• No extrapolation made 
• High blosum - closely related sequences 
• Low blosum - distant sequences 
• blosum45  pam250 
• blosum62  pam160 
• blosum62 is the most popular matrix 
The BLOSUM Series
Overview
• Church of the Flying Spaghetti Monster 
• http://www.venganza.org/about/open-letter
• Which matrix should I use? 
– Matrices derived from observed substitution data 
(e.g. the Dayhoff or BLOSUM matrices) are 
superior to identity, genetic code or physical 
property matrices. 
– Schwartz and Dayhoff recommended a mutation 
data matrix for the distance of 250 PAMs as a 
result of a study using a dynamic programming 
procedure to compare a variety of proteins known 
to be distantly related. 
• The 250 PAM matrix was selected since in Monte 
Carlo studies matrices reflecting this evolutionary 
distance gave a consistently higher significance 
score than other matrices in the range 0.750 PAM. 
The matrix also gave better scores when compared 
to the genetic code matrix and identity scoring. 
Overview
Which matrix should I use? 
• When comparing sequences that were not 
known in advance to be related, for 
example when database scanning: 
– default scoring matrix used is the 
BLOSUM62 matrix 
– if one is restricted to using 
only PAM scoring matrices, then 
the PAM120 is recommended for 
general protein similarity searches 
• When using a local alignment method, 
Altschul suggests that three matrices 
should ideally be used: PAM40, PAM120 
and PAM250, the lower PAM matrices will 
tend to find short alignments of highly 
similar sequences, while higher PAM 
matrices will find longer, weaker local 
alignments.
Rat versus 
mouse RBP 
Rat versus 
bacterial 
lipocalin
– Henikoff and Henikoff have compared the 
BLOSUM matrices to PAM by evaluating how 
effectively the matrices can detect known members 
of a protein family from a database when searching 
with the ungapped local alignment program 
BLAST. They conclude that overall the BLOSUM 
62 matrix is the most effective. 
• However, all the substitution matrices investigated 
perform better than BLOSUM 62 for a proportion of 
the families. This suggests that no single matrix is 
the complete answer for all sequence comparisons. 
• It is probably best to compliment the BLOSUM 62 
matrix with comparisons using 250 PAMS, and 
Overington structurally derived matrices. 
– It seems likely that as more protein three 
dimensional structures are determined, substitution 
tables derived from structure comparison will give 
the most reliable data. 
Overview
Overview 
• Introduction 
– Short recap on databases 
– Definitions 
• Scoring Matrices 
– Theoretical 
– Empirial 
• PAM (pam-simulator.pl) 
• BLOSUM 
• Pairwise alignment 
– Dot-plots (dotplot-simulator.pl) 
Overview
Dotplots 
• What is it ? 
– Graphical representation using two orthogonal 
axes and “dots” for regions of similarity. 
– In a bioinformatics context two sequence are 
used on the axes and dots are plotted when a 
given treshold is met in a given window. 
• Dot-plotting is the best way to see all of the 
structures in common between two 
sequences or to visualize all of the repeated 
or inverted repeated structures in one 
sequence
Dot Plot References 
Gibbs, A. J. & McIntyre, G. A. (1970). 
The diagram method for comparing sequences. its use with 
amino acid and nucleotide sequences. 
Eur. J. Biochem. 16, 1-11. 
Staden, R. (1982). 
An interactive graphics program for comparing and aligning 
nucleic-acid and amino-acid sequences. 
Nucl. Acid. Res. 10 (9), 2951-2961.
Visual Alignments (Dot Plots) 
• Matrix 
– Rows: Characters in one sequence 
– Columns: Characters in second sequence 
• Filling 
– Loop through each row; if character in row, col match, fill 
in the cell 
– Continue until all cells have been examined
Dotplot-simulator.pl 
print " $seq1n"; 
for(my $teller=0;$teller<=$seq2_length;$teller++){ 
print substr($seq2,$teller,1); 
$w2=substr($seq2,$teller,$window); 
for(my $teller2=0;$teller2<=$seq_length;$teller2++){ 
$w1=substr($seq1,$teller2,$window); 
if($w1 eq $w2){print "*";}else{print " ";} 
} 
print"n"; 
}
Overview 
Window size = 1, stringency 100%
Noise in Dot Plots 
• Nucleic Acids (DNA, RNA) 
– 1 out of 4 bases matches at random 
• Stringency 
– Window size is considered 
– Percentage of bases matching in the window is 
set as threshold
Reduction of Dot Plot Noise 
Self alignment of ACCTGAGCTCACCTGAGTTA
Dotplot-simulator.pl 
Example: ZK822 Genomic and cDNA 
Gene prediction: 
How many exons ? 
Confirm donor and aceptor sites ? 
Remember to check the reverse complement !
Chromosome Y self comparison
• Regions of similarity appear 
as diagonal runs of dots 
• Reverse diagonals 
(perpendicular to diagonal) 
indicate inversions 
• Reverse diagonals crossing 
diagonals (Xs) indicate 
palindromes 
• A gap is introduced by each 
vertical or horizontal skip 
Overview
• Window size changes with goal 
of analysis 
– size of average exon 
– size of average protein structural 
element 
– size of gene promoter 
– size of enzyme active site 
Overview
Rules of thumb 
 Don't get too many points, about 3- 
5 times the length of the sequence 
is about right (1-2%) 
 Window size about 20 for distant 
proteins 12 for nucleic acid 
 Check sequence vs. itself 
 Check sequence vs. sequence 
 Anticipate results 
(e.g. “in-house” sequence vs genomic, 
question) 
Overview
Available Dot Plot Programs 
Dotlet (Java Applet) 
http://www.isrec.isb-sib. 
ch/java/dotlet/Dotlet. 
html
Available Dot Plot Programs 
Dotter (http://www.cgr.ki.se/cgr/groups/sonnhammer/Dotter.html)
Available Dot Plot Programs 
EMBOSS DotMatcher, DotPath,DotUp
Weblems 
• W3.1: Why does 2 PAM, i.e. 1 PAM multiplied with itself, 
not correspond to exactly 2% of the amino acids having 
mutated, but a little less than 2% ? Or, in other words, why 
does a 250 PAM matrix not correspond to 250% accepted 
mutations ? 
• W3.2: Is it biologically plausible that the C-C and W-W 
entries in the scoring matrices are the most prominent ? 
Which entries (or groups of entries) are the least prominent ? 
• W3.3: What is OMIM ? How many entries are there ? What 
percentage of OMIM listed diseases has no known (gene) 
cause ? 
• W3.4: Pick one disease mapped to chromosome Y from 
OMIM where only a mapping region is known. How many 
candidate genes can you find in the locus using ENSEMBL ? 
Can you link ontology terms for the candidates to the disease 
phenotype ?

More Related Content

PDF
20120140504026
PPTX
Bioinformatica t2-databases
PPTX
Scoring matrices
PPTX
Bioinformatica t3-scoring matrices-wim_vancriekinge_v2013
PPTX
2016 bioinformatics i_score_matrices_wim_vancriekinge
PPTX
2015 bioinformatics score_matrices_wim_vancriekinge
PPT
Sequence Analysis.ppt
PPT
20100515 bioinformatics kapushesky_lecture07
20120140504026
Bioinformatica t2-databases
Scoring matrices
Bioinformatica t3-scoring matrices-wim_vancriekinge_v2013
2016 bioinformatics i_score_matrices_wim_vancriekinge
2015 bioinformatics score_matrices_wim_vancriekinge
Sequence Analysis.ppt
20100515 bioinformatics kapushesky_lecture07

Similar to Bioinformatica t3-scoringmatrices v2014 (20)

PDF
Ch06 alignment
PPT
Bioinformatica 20-10-2011-t3-scoring matrices
DOCX
2016.09.28TOPIC REVIEW• Exam • PS2 Sequence Alignment .docx
PPTX
Bioinformatics life sciences_v2015
PPT
Kyle Jensen's MIT Ph.D. Thesis Proposal
PDF
BITS: Basics of Sequence similarity
PPT
Blast fasta 4
PDF
Mathcad - CMS (Component Mode Synthesis) Analysis.pdf
PPTX
Technology used for High Level Expression and Purification of Recombinant Pro...
PDF
Traditional vs Nontraditional Methods for Network Analytics - Ernesto Estrada
PPTX
Global and local alignment (bioinformatics)
PPT
Compact Street Lights - 25W LED STELLAR STREET LIGHT Specifications
PPT
Bioinformatica 27-10-2011-t4-alignments
PPT
Geohydrology ii (3)
PPT
Lecture 14
PPTX
Valerie de Anda at #ICG12: A new multi-genomic approach for the study of biog...
PPTX
Bioinformatics t4-alignments wim_vancriekingev2013
PPTX
Bioinformatica t3-scoring matrices
PPTX
MDC Connects: Cell-based screening: Old dogs with new tricks
PPT
Similarity
Ch06 alignment
Bioinformatica 20-10-2011-t3-scoring matrices
2016.09.28TOPIC REVIEW• Exam • PS2 Sequence Alignment .docx
Bioinformatics life sciences_v2015
Kyle Jensen's MIT Ph.D. Thesis Proposal
BITS: Basics of Sequence similarity
Blast fasta 4
Mathcad - CMS (Component Mode Synthesis) Analysis.pdf
Technology used for High Level Expression and Purification of Recombinant Pro...
Traditional vs Nontraditional Methods for Network Analytics - Ernesto Estrada
Global and local alignment (bioinformatics)
Compact Street Lights - 25W LED STELLAR STREET LIGHT Specifications
Bioinformatica 27-10-2011-t4-alignments
Geohydrology ii (3)
Lecture 14
Valerie de Anda at #ICG12: A new multi-genomic approach for the study of biog...
Bioinformatics t4-alignments wim_vancriekingev2013
Bioinformatica t3-scoring matrices
MDC Connects: Cell-based screening: Old dogs with new tricks
Similarity
Ad

More from Prof. Wim Van Criekinge (20)

PPTX
2020 02 11_biological_databases_part1
PPTX
2019 03 05_biological_databases_part5_v_upload
PPTX
2019 03 05_biological_databases_part4_v_upload
PPTX
2019 03 05_biological_databases_part3_v_upload
PPTX
2019 02 21_biological_databases_part2_v_upload
PPTX
2019 02 12_biological_databases_part1_v_upload
PPTX
P7 2018 biopython3
PPTX
P6 2018 biopython2b
PPTX
P4 2018 io_functions
PPTX
P3 2018 python_regexes
PPTX
T1 2018 bioinformatics
PPTX
P1 2018 python
PDF
Bio ontologies and semantic technologies[2]
PPTX
2018 05 08_biological_databases_no_sql
PPTX
2018 03 27_biological_databases_part4_v_upload
PPTX
2018 03 20_biological_databases_part3
PPTX
2018 02 20_biological_databases_part2_v_upload
PPTX
2018 02 20_biological_databases_part1_v_upload
PPTX
P7 2017 biopython3
PPTX
P6 2017 biopython2
2020 02 11_biological_databases_part1
2019 03 05_biological_databases_part5_v_upload
2019 03 05_biological_databases_part4_v_upload
2019 03 05_biological_databases_part3_v_upload
2019 02 21_biological_databases_part2_v_upload
2019 02 12_biological_databases_part1_v_upload
P7 2018 biopython3
P6 2018 biopython2b
P4 2018 io_functions
P3 2018 python_regexes
T1 2018 bioinformatics
P1 2018 python
Bio ontologies and semantic technologies[2]
2018 05 08_biological_databases_no_sql
2018 03 27_biological_databases_part4_v_upload
2018 03 20_biological_databases_part3
2018 02 20_biological_databases_part2_v_upload
2018 02 20_biological_databases_part1_v_upload
P7 2017 biopython3
P6 2017 biopython2
Ad

Recently uploaded (20)

PPTX
Pharmacology of Heart Failure /Pharmacotherapy of CHF
PDF
Abdominal Access Techniques with Prof. Dr. R K Mishra
PDF
VCE English Exam - Section C Student Revision Booklet
PPTX
Final Presentation General Medicine 03-08-2024.pptx
PDF
The Lost Whites of Pakistan by Jahanzaib Mughal.pdf
PDF
BÀI TẬP BỔ TRỢ 4 KỸ NĂNG TIẾNG ANH 9 GLOBAL SUCCESS - CẢ NĂM - BÁM SÁT FORM Đ...
PDF
Chapter 2 Heredity, Prenatal Development, and Birth.pdf
PDF
Basic Mud Logging Guide for educational purpose
PPTX
Pharma ospi slides which help in ospi learning
PDF
01-Introduction-to-Information-Management.pdf
PDF
grade 11-chemistry_fetena_net_5883.pdf teacher guide for all student
PDF
Sports Quiz easy sports quiz sports quiz
PPTX
Cell Structure & Organelles in detailed.
PDF
Complications of Minimal Access Surgery at WLH
PDF
Classroom Observation Tools for Teachers
PDF
Microbial disease of the cardiovascular and lymphatic systems
PPTX
master seminar digital applications in india
PPTX
GDM (1) (1).pptx small presentation for students
PDF
Pre independence Education in Inndia.pdf
PPTX
human mycosis Human fungal infections are called human mycosis..pptx
Pharmacology of Heart Failure /Pharmacotherapy of CHF
Abdominal Access Techniques with Prof. Dr. R K Mishra
VCE English Exam - Section C Student Revision Booklet
Final Presentation General Medicine 03-08-2024.pptx
The Lost Whites of Pakistan by Jahanzaib Mughal.pdf
BÀI TẬP BỔ TRỢ 4 KỸ NĂNG TIẾNG ANH 9 GLOBAL SUCCESS - CẢ NĂM - BÁM SÁT FORM Đ...
Chapter 2 Heredity, Prenatal Development, and Birth.pdf
Basic Mud Logging Guide for educational purpose
Pharma ospi slides which help in ospi learning
01-Introduction-to-Information-Management.pdf
grade 11-chemistry_fetena_net_5883.pdf teacher guide for all student
Sports Quiz easy sports quiz sports quiz
Cell Structure & Organelles in detailed.
Complications of Minimal Access Surgery at WLH
Classroom Observation Tools for Teachers
Microbial disease of the cardiovascular and lymphatic systems
master seminar digital applications in india
GDM (1) (1).pptx small presentation for students
Pre independence Education in Inndia.pdf
human mycosis Human fungal infections are called human mycosis..pptx

Bioinformatica t3-scoringmatrices v2014

  • 2. FBW 13-10-2014 Wim Van Criekinge
  • 3. Wel les op 4 november en GEEN les op 18 november
  • 4. Overview • Introduction – Short recap on databases – Definitions • Scoring Matrices – Theoretical – Empirial • PAM (pam-simulator.pl) • BLOSUM • Pairwise alignment – Dot-plots (dotplot-simulator.pl) Overview
  • 5. Major sites NCBI - The National Center for Biotechnology Information http://www.ncbi.nlm.nih.gov/ The National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), a part of the National Institutes of Health (NIH). ExPASy - Molecular Biology Server http://expasy.hcuge.ch/www/ Molecular biology WWW server of the Swiss Institute of Bioinformatics (SIB). This server is dedicated to the analysis of protein sequences and structures as well as 2-D PAGE EBI - European Bioinformatics Institute http://www.ebi.ac.uk/
  • 19. Overview • Introduction – Short recap on databases – Definitions • Scoring Matrices – Theoretical – Empirial • PAM (pam-simulator.pl) • BLOSUM • Pairwise alignment – Dot-plots (dotplot-simulator.pl) Overview
  • 20. Definitions Identity The extent to which two (nucleotide or amino acid) sequences are invariant. Homology Similarity attributed to descent from a common ancestor. RBP: 26 RVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWD- 84 + K ++ + + GTW++MA+ L + A V T + +L+ W+ glycodelin: 23 QTKQDLELPKLAGTWHSMAMA-TNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWEN 81
  • 21. Definitions Orthologous Homologous sequences in different species that arose from a common ancestral gene during speciation; may or may not be responsible for a similar function. Paralogous Homologous sequences within a single species that arose by gene duplication.
  • 23. Multiple sequence alignment of glyceraldehyde- 3-phsophate dehydrogenases fly GAKKVIISAP SAD.APM..F VCGVNLDAYK PDMKVVSNAS CTTNCLAPLA human GAKRVIISAP SAD.APM..F VMGVNHEKYD NSLKIISNAS CTTNCLAPLA plant GAKKVIISAP SAD.APM..F VVGVNEHTYQ PNMDIVSNAS CTTNCLAPLA bacterium GAKKVVMTGP SKDNTPM..F VKGANFDKY. AGQDIVSNAS CTTNCLAPLA yeast GAKKVVITAP SS.TAPM..F VMGVNEEKYT SDLKIVSNAS CTTNCLAPLA archaeon GADKVLISAP PKGDEPVKQL VYGVNHDEYD GE.DVVSNAS CTTNSITPVA fly KVINDNFEIV EGLMTTVHAT TATQKTVDGP SGKLWRDGRG AAQNIIPAST human KVIHDNFGIV EGLMTTVHAI TATQKTVDGP SGKLWRDGRG ALQNIIPAST plant KVVHEEFGIL EGLMTTVHAT TATQKTVDGP SMKDWRGGRG ASQNIIPSST bacterium KVINDNFGII EGLMTTVHAT TATQKTVDGP SHKDWRGGRG ASQNIIPSST yeast KVINDAFGIE EGLMTTVHSL TATQKTVDGP SHKDWRGGRT ASGNIIPSST archaeon KVLDEEFGIN AGQLTTVHAY TGSQNLMDGP NGKP.RRRRA AAENIIPTST fly GAAKAVGKVI PALNGKLTGM AFRVPTPNVS VVDLTVRLGK GASYDEIKAK human GAAKAVGKVI PELNGKLTGM AFRVPTANVS VVDLTCRLEK PAKYDDIKKV plant GAAKAVGKVL PELNGKLTGM AFRVPTSNVS VVDLTCRLEK GASYEDVKAA bacterium GAAKAVGKVL PELNGKLTGM AFRVPTPNVS VVDLTVRLEK AATYEQIKAA yeast GAAKAVGKVL PELQGKLTGM AFRVPTVDVS VVDLTVKLNK ETTYDEIKKV archaeon GAAQAATEVL PELEGKLDGM AIRVPVPNGS ITEFVVDLDD DVTESDVNAA
  • 24. This power of sequence alignments • empirical finding: if two biological sequences are sufficiently similar, almost invariably they have similar biological functions and will be descended from a common ancestor. • (i) function is encoded into sequence, this means: the sequence provides the syntax and • (ii) there is a redundancy in the encoding, many positions in the sequence may be changed without perceptible changes in the function, thus the semantics of the encoding is robust.
  • 25. Overview • Introduction – Short recap on databases – Definitions • Scoring Matrices – Theoretical – Empirial • PAM (pam-simulator.pl) • BLOSUM • Pairwise alignment – Dot-plots (dotplot-simulator.pl) Overview
  • 26. A metric … It is very important to realize, that all subsequent results depend critically on just how this is done and what model lies at the basis for the construction of a specific scoring matrix. A scoring matrix is a tool to quantify how well a certain model is represented in the alignment of two sequences, and any result obtained by its application is meaningful exclusively in the context of that model.
  • 27. Importance of scoring matrices Scoring matrices appear in all analysis involving sequence comparison.  The choice of matrix can strongly influence the outcome of the analysis.  Scoring matrices implicitly represent a particular theory of evolution.  Understanding theories underlying a given scoring matrix can aid in making proper choice. • Nucleic acid and Protein Scoring Matrices
  • 28. Nucleic Acid Scoring Matrices • Identity matrix (similarity) BLAST matrix (similarity) A T C G A T C G A 1 0 0 0 A 5 -4 -4 -4 T 0 1 0 0 T -4 5 -4 -4 C 0 0 1 0 C -4 -4 5 -4 G 0 0 0 1 G -4 -4 -4 5 • Transition/Transversion Matrix A T C G A 0 5 5 1 T 5 0 1 5 C 5 1 0 5 G 1 5 5 0 A and T purine -pyrimidine G and C purine-pyrimidine
  • 29. Transition/Transversion Matrix • Nucleotide bases fall into two categories depending on the ring structure of the base. Purines (Adenine and Guanine) are two ring bases, pyrimidines (Cytosine and Thymine) are single ring bases. Mutations in DNA are changes in which one base is replaced by another. • A mutation that conserves the ring number is called a transition (e.g., A -> G or C -> T) a mutation that changes the ring number are called transversions. (e.g. A -> C or A -> T and so on). A T C G A 0 5 5 1 T 5 0 1 5 C 5 1 0 5 G 1 5 5 0
  • 30. Transition/Transversion Matrix • Although there are more ways to create a transversion, the number of transitions observed to occur in nature (i.e., when comparing related DNA sequences) is much greater. Since the likelihood of transitions is greater, it is sometimes desireable to create a weight matrix which takes this propensity into account when comparing two DNA sequences. • Use of a Transition/Transversion Matrix reduces noise in comparisons of distantly related sequences. A T C G A 0 5 5 1 T 5 0 1 5 C 5 1 0 5 G 1 5 5 0
  • 31. Protein Scoring Matrices: Unitary Matrix • The simplest metric in use is the identity metric. • If two amino acids are the same, they are given one score, if they are not, they are given a different score - regardless, of what the replacement is. • One may give a score of 1 for matches and 0 for mismatches - this leads to the frequently used unitary matrix
  • 32. Protein Scoring Matrices: Unitary Matrix A R N D C Q E G H I L K M F P S T W Y V A 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 N 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 D 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 C 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 E 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 G 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 H 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 I 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 K 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 M 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 F 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 P 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 S 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 T 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 W 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 Y 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 V 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1
  • 33. Protein Scoring Matrices: Unitary Matrix • The simplest matrix: – High scores for Identities – Low scores for non-identities • Works for closely related proteins • Or one could assign +6 for a match and -1 for a mismatch, this would be a matrix useful for local alignment procedures, where a negative expectation value for randomly aligned sequences is required to ensure that the score will not grow simply from extending the alignment in a random way.
  • 34. A very crude model of an evolutionary relationship could be implemented in a scoring matrix in the following way: since all point-mutations arise from nucleotide changes, the probability that an observed amino acid pair is related by chance, rather than inheritance should depend on the number of point mutations necessary to transform one codon into the other. A metric resulting from this model would define the distance between two amino acids by the minimal number of nucleotide changes required. Genetic Code Matrix
  • 35. Genetic Code Matrix The table is generated by calculating the minimum number of base changes required to convert an amino acid in row i to an amino acid in column j. Note Met->Tyr is the only change that requires all 3 codon positions to change. A S G L K V T P E D N I Q R F Y C H M W Z B X Ala = A O 1 1 2 2 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 Ser = S 1 O 1 1 2 2 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 2 Gly = G 1 1 0 2 2 1 2 2 1 1 2 2 2 1 2 2 1 2 2 1 2 2 2 Leu = L 2 1 2 0 2 1 2 1 2 2 2 1 1 1 1 2 2 1 1 1 2 2 2 Lys = K 2 2 2 2 0 2 1 2 1 2 1 1 1 1 2 2 2 2 1 2 1 2 2 Val = V 1 2 1 1 2 0 2 2 1 1 2 1 2 2 1 2 2 2 1 2 2 2 2 Thr = T 1 1 2 2 1 2 0 1 2 2 1 1 2 1 2 2 2 2 1 2 2 2 2 Pro = P 1 1 2 1 2 2 1 0 2 2 2 2 1 1 2 2 2 1 2 2 2 2 2 Glu - E 1 2 1 2 1 1 2 2 0 1 2 2 1 2 2 2 2 2 2 2 1 2 2 Asp = D 1 2 1 2 2 1 2 2 1 O 1 2 2 2 2 1 2 1 2 2 2 1 2 Asn = N 2 1 2 2 1 2 1 2 2 1 O 1 2 2 2 1 2 1 2 2 2 1 2 Ile = I 2 1 2 1 1 1 1 2 2 2 1 0 2 1 1 2 2 2 1 2 2 2 2 Gln = Q 2 2 2 1 1 2 2 1 1 2 2 2 0 1 2 2 2 1 2 2 1 2 2 Arg = R 2 1 1 1 1 2 1 1 2 2 2 1 1 0 2 2 1 1 1 1 2 2 2 Phe = F 2 1 2 1 2 1 2 2 2 2 2 1 2 2 0 1 1 2 2 2 2 2 2 Tyr = Y 2 1 2 2 2 2 2 2 2 1 1 2 2 2 1 O 1 1 3 2 2 1 2 Cys = C 2 1 1 2 2 2 2 2 2 2 2 2 2 1 1 1 0 2 2 1 2 2 2 His = H 2 2 2 1 2 2 2 1 2 1 1 2 1 1 2 1 2 0 2 2 2 1 2 Met = M 2 2 2 1 1 1 1 2 2 2 2 1 2 1 2 3 2 2 0 2 2 2 2 Trp = W 2 1 1 1 2 2 2 2 2 2 2 2 2 1 2 2 1 2 2 0 2 2 2 Glx = Z 2 2 2 2 1 2 2 2 1 2 2 2 1 2 2 2 2 2 2 2 1 2 2 Asx = B 2 2 2 2 2 2 2 2 2 1 1 2 2 2 2 1 2 1 2 2 2 1 2 ??? = X 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2
  • 36. This genetic code matrix already improves sensitivity and specificity of alignments from the identity matrix. The fact that the genetic code matrix works to align related proteins, in the same way that matrices derived from amino-acid properties work says something very interesting about the genetic code: namely that it appears to have evolved to minimize the effects of point mutations. Genetic Code Matrix
  • 38. • Simple identity, which scores only identical amino acids as a match. • Genetic code changes, which scores the minimum number of nucieotide changes to change a codon for one amino acid into a codon for the other. • Chemical similarity of amino acid side chains, which scores as a match two amino acids which have a similar side chain, such as hydrophobic, charged and polar amino acid groups. Overview
  • 39. All proteins are polymers of the 20 naturally occuring amino acids. They are listed here along with their abbreviations :- Alanine Ala A Cysteine Cys C Aspartic AciD Asp D Glutamic Acid Glu E Phenylalanine Phe F Glycine Gly G Histidine His H Isoleucine Ile I Lysine Lys K Leucine Leu L Methionine Met M AsparagiNe Asn N Proline Pro P Glutamine Gln Q ARginine Arg R Serine Ser S Threonine Thr T Valine Val V Tryptophan Trp W TYrosine Tyr Y Amino Acid Residues
  • 40. All amino acids have the same general formula Amino Acid Residues
  • 41. • Hydrophobic-aliphatic amino acids: Their side chains consist of non-polar methyl- or methylene-groups. – These amino acids are usually located on the interior of the protein as they are hydrophobic in nature. – All except for alanine are bifurcated. In the cases of Val and Ile the bifurcation is close to the main chain and can therefore restrict the conformation of the polypeptide by steric hindrance. – red and blue atoms represent polar main chain groups Amino Acid Residues
  • 43. • Hydrophobic-aromatic: Only phenylalanine is entirely non-polar. Tyrosine's phenolic side chain has a hydroxyl substituent and tryptophan has a nitrogen atom in its indole ring sytem. – These residues are nearly always found to be largely buried in the hydrophobic interior of a proteins as they are prdeominantly non-polar in nature. – However, the polar atoms of tyrosine and tryptophan allow hydrogen bonding interactions to be made with other residues or even solvent molecules Amino Acid Residues
  • 45. Neutral-polar side chains: a number of small aliphatic side chains containing polar groups which cannot ionize readily. – Serine and threonine possess hydroxyl groups in their side chains and as these polar groups are close to the main chain they can form hydrogen bonds with it. This can influence the local conformation of the polypeptide, – Residues such as serine and asparagine are known to adopt conformations which most other amino acids cannot. – The amino acids asparagine and glutamine posses amide groups in their side chains which are usually hydrogen-bonded whenever they occur in the interior of a protein. Amino Acid Residues
  • 47. • Acidic amino acids: Aspartate and glutamate have carboxyl side chains and are therefore negatively charged at physiological pH (around neutral). – The strongly polar nature of these residues means that they are most often found on the surface of globular proteins where they can interact favourably with solvent molecules. – These residues can also take part in electrostatic interactions with positively charged basic amino acids. – Aspartate and glutamate also can take on catalytic roles in the active sites of enzymes and are well known for their metal ion binding abilities Amino Acid Residues
  • 49. • Basic amino acids: – histidine has the lowest pKa (around 6) and is therefore neutral at around physiological pH. • This amino acid occurs very frequently in enzyme active sites as it can function as a very efficient general acid-base catalyst. • It also acts as a metal ion ligand in numerous protein families. – Lysine and arginine are more strongly basic and are positively charged at physiological pH's. They are generally solvated but do occasionally occur in the interior of a protein where they are usually involved in electrostatic interactions with negatively charged groups such as Asp or Glu. • Lys and Arg have important roles in anion-binding proteins as they can interact electrostatically with the ligand. Amino Acid Residues
  • 51. Conformationally important residues: Glycine and proline are unique amino acids. They appear to influence the conformation of the polypeptide. • Glycine essentially lacks a side chain and therefore can adopt conformations which are sterically forbidden for other amino acids. This confers a high degree of local flexibility on the polypeptide. – Accordingly, glycine residues are frequently found in turn regions of proteins where the backbone has to make a sharp turn. – Glycine occurs abundantly in certain fibrous proteins due to its flexibility and because its small size allows adjacent polypeptide chains to pack together closely. • In contrast, proline is the most rigid of the twenty naturally occurring amino acids since its side chain is covalently linked with the main chain nitrogen Amino Acid Residues
  • 53. Here is one list where amino acids are grouped according to the characteristics of the side chains:  Aliphatic - alanine, glycine, isoleucine, leucine, proline, valine,  Aromatic - phenylalanine, tryptophan, tyrosine,  Acidic - aspartic acid, glutamic acid,  Basic - arginine, histidine, lysine,  Hydroxylic - serine, threonine  Sulphur-containing - cysteine, methionine  Amidic (containing amide group) - asparagine, glutamine Amino Acid Residues
  • 54. Hydrophobicity matrix R K D E B Z S N Q G X T H A C M P V L I Y F W Arg = R 10 10 9 9 8 8 6 6 6 5 5 5 5 5 4 3 3 3 3 3 2 1 0 Lys = K 10 10 9 9 8 8 6 6 6 5 5 5 5 5 4 3 3 3 3 3 2 1 0 Asp = D 9 9 10 10 8 8 7 6 6 6 5 5 5 5 5 4 4 4 3 3 3 2 1 Glu = E 9 9 10 10 8 8 7 6 6 6 5 5 5 5 5 4 4 4 3 3 3 2 1 Asx = B 8 8 8 8 10 10 8 8 8 8 7 7 7 7 6 6 6 5 5 5 4 4 3 Glx = Z 8 8 8 8 10 10 8 8 8 8 7 7 7 7 6 6 6 5 5 5 4 4 3 Ser = S 6 6 7 7 8 8 10 10 10 10 9 9 9 9 8 8 7 7 7 7 6 6 4 Asn = N 6 6 6 6 8 8 10 10 10 10 9 9 9 9 8 8 8 7 7 7 6 6 4 Gln = Q 6 6 6 6 8 8 10 10 10 10 9 9 9 9 8 8 8 7 7 7 6 6 4 Gly = G 5 5 6 6 8 8 10 10 10 10 9 9 9 9 8 8 8 8 7 7 6 6 5 ??? = X 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 8 8 8 8 7 7 5 Thr = T 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 8 8 8 8 7 7 5 His = H 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 9 8 8 8 7 7 5 Ala = A 5 5 5 5 7 7 9 9 9 9 10 10 10 10 9 9 9 8 8 8 7 7 5 Cys = C 4 4 5 5 6 6 8 8 8 8 9 9 9 9 10 10 9 9 9 9 8 8 5 Met = M 3 3 4 4 6 6 8 8 8 8 9 9 9 9 10 10 10 10 9 9 8 8 7 Pro = P 3 3 4 4 6 6 7 8 8 8 8 8 9 9 9 10 10 10 9 9 9 8 7 Val = V 3 3 4 4 5 5 7 7 7 8 8 8 8 8 9 10 10 10 10 10 9 8 7 Leu = L 3 3 3 3 5 5 7 7 7 7 8 8 8 8 9 9 9 10 10 10 9 9 8 Ile = I 3 3 3 3 5 5 7 7 7 7 8 8 8 8 9 9 9 10 10 10 9 9 8 Tyr = Y 2 2 3 3 4 4 6 6 6 6 7 7 7 7 8 8 9 9 9 9 10 10 8 Phe = F 1 1 2 2 4 4 6 6 6 6 7 7 7 7 8 8 8 8 9 9 10 10 9 Trp = W 0 0 1 1 3 3 4 4 4 5 5 5 5 5 6 7 7 7 8 8 8 9 10 •Physical/Chemical characteristics: Attempt to quantify some physical or chemical attribute of •the residues and arbitrarily assign weights based on similarities of the residues in this chosen property.
  • 55. Other similarity scoring matrices might be constructed from any property of amino acids that can be quantified - partition coefficients between hydrophobic and hydrophilic phases - charge - molecular volume Unfortunately, …
  • 56. AAindex Amino acid indices and similarity matrices (http://www.genome.ad.jp/dbget/aaindex.html) List of 494 Amino Acid Indices in AAindex ver.6.0 • ANDN920101 alpha-CH chemical shifts (Andersen et al., 1992) • ARGP820101 Hydrophobicity index (Argos et al., 1982) • ARGP820102 Signal sequence helical potential (Argos et al., 1982) • ARGP820103 Membrane-buried preference parameters (Argos et al., 1982) • BEGF750101 Conformational parameter of inner helix (Beghin-Dirkx, 1975) • BEGF750102 Conformational parameter of beta-structure (Beghin-Dirkx, 1975) • BEGF750103 Conformational parameter of beta-turn (Beghin-Dirkx, 1975) • BHAR880101 Average flexibility indices (Bhaskaran-Ponnuswamy, 1988) • BIGC670101 Residue volume (Bigelow, 1967) • BIOV880101 Information value for accessibility; average fraction 35% (Biou et al., 1988) • BIOV880102 Information value for accessibility; average fraction 23% (Biou et al., 1988) • BROC820101 Retention coefficient in TFA (Browne et al., 1982) • BROC820102 Retention coefficient in HFBA (Browne et al., 1982) • BULH740101 Transfer free energy to surface (Bull-Breese, 1974) • BULH740102 Apparent partial specific volume (Bull-Breese, 1974)
  • 57. Protein Eng. 1996 Jan;9(1):27-36.
  • 58. • Simple identity, which scores only identical amino acids as a match. • Genetic code changes, which scores the minimum number of nucieotide changes to change a codon for one amino acid into a codon for the other. • Chemical similarity of amino acid side chains, which scores as a match two amino acids which have a similar side chain, such as hydrophobic, charged and polar amino acid groups. • The Dayhoff percent accepted mutation (PAM) family of matrices, which scores amino acid pairs on the basis of the expected frequency of substitution of one amino acid for the other during protein evolution. Overview
  • 59. • In the absence of a valid model derived from first principles, an empirical approach seems more appropriate to score amino acid similarity. • This approach is based on the assumption that once the evolutionary relationship of two sequences is established, the residues that did exchange are similar. Dayhoff Matrix
  • 60. Model of Evolution: “Proteins evolve through a succesion of independent point mutations, that are accepted in a population and subsequently can be observed in the sequence pool.” Definition: The evolutionary distance between two sequences is the (minimal) number of point mutations that was necessary to evolve one sequence into the other Overview
  • 61. • The model used here states that proteins evolve through a succesion of independent point mutations, that are accepted in a population and subsequently can be observed in the sequence pool. • We can define an evolutionary distance between two sequences as the number of point mutations that was necessary to evolve one sequence into the other. Principle
  • 62. • M.O. Dayhoff and colleagues introduced the term "accepted point mutation" for a mutation that is stably fixed in the gene pool in the course of evolution. Thus a measure of evolutionary distance between two sequences can be defined: • A PAM (Percent accepted mutation) is one accepted point mutation on the path between two sequences, per 100 residues. Overview
  • 63. Principles of Scoring Matrix Construction First step: finding “accepted mutations” In order to identify accepted point mutations, a complete phylogenetic tree including all ancestral sequences has to be constructed. To avoid a large degree of ambiguities in this step, Dayhoff and colleagues restricted their analysis to sequence families with more than 85% identity.
  • 64. Identification of accepted point mutations: •Collection of correct (manual) alignments • 1300 sequences in 72 families • closely related in order not to get multiply changes at the same position • Construct a complete phylogenetic tree including all ancestral sequences. • Dayhoff et al restricted their analysis to sequence families with more than 85% identity. • Tabulate into a 20x20 matrix the amino acid pair exchanges for each of the observed and inferred sequences. Overview
  • 65. ACGH DBGH ADIJ CBIJ / / / / B - C / A - D B - D / A - C / / / / ABGH ABIJ / I - G / J - H / / / | | | Overview
  • 66. Dayhoff’s PAM1 mutation probability matrix (Transition Matrix) A Ala R Arg N Asn D Asp C Cys Q Gln E Glu G Gly H His I Ile A 9867 2 9 10 3 8 17 21 2 6 R 1 9913 1 0 1 10 0 0 10 3 N 4 1 9822 36 0 4 6 6 21 3 D 6 0 42 9859 0 6 53 6 4 1 C 1 1 0 0 9973 0 0 0 1 1 Q 3 9 4 5 0 9876 27 1 23 1 E 10 0 7 56 0 35 9865 4 2 3 G 21 1 12 11 1 3 7 9935 1 0 H 1 8 18 3 1 20 1 0 9912 0 I 2 2 3 1 2 1 2 0 0 9872
  • 67. PAM1: Transition Matrix Ala Arg Asn Asp Cys Gln Glu Gly His Ile Leu Lys Met Phe Pro Ser Thr Trp Tyr Val A R N D C Q E G H I L K M F P S T W Y V Ala A 9867 2 9 10 3 8 17 21 2 6 4 2 6 2 22 35 32 0 2 18 Arg R 1 9913 1 0 1 10 0 0 10 3 1 19 4 1 4 6 1 8 0 1 Asn N 4 1 9822 36 0 4 6 6 21 3 1 13 0 1 2 20 9 1 4 1 Asp D 6 0 42 9859 0 6 53 6 4 1 0 3 0 0 1 5 3 0 0 1 Cys C 1 1 0 0 9973 0 0 0 1 1 0 0 0 0 1 5 1 0 3 2 Gln Q 3 9 4 5 0 9876 27 1 23 1 3 6 4 0 6 2 2 0 0 1 Glu E 10 0 7 56 0 35 9865 4 2 3 1 4 1 0 3 4 2 0 1 2 Gly G 21 1 12 11 1 3 7 9935 1 0 1 2 1 1 3 21 3 0 0 5 His H 1 8 18 3 1 20 1 0 9912 0 1 1 0 2 3 1 1 1 4 1 Ile I 2 2 3 1 2 1 2 0 0 9872 9 2 12 7 0 1 7 0 1 33 Leu L 3 1 3 0 0 6 1 1 4 22 9947 2 45 13 3 1 3 4 2 15 Lys K 2 37 25 6 0 12 7 2 2 4 1 9926 20 0 3 8 11 0 1 1 Met M 1 1 0 0 0 2 0 0 0 5 8 4 9874 1 0 1 2 0 0 4 Phe F 1 1 1 0 0 0 0 1 2 8 6 0 4 9946 0 2 1 3 28 0 Pro P 13 5 2 1 1 8 3 2 5 1 2 2 1 1 9926 12 4 0 0 2 Ser S 28 11 34 7 11 4 6 16 2 2 1 7 4 3 17 9840 38 5 2 2 Thr T 22 2 13 4 1 3 2 2 1 11 2 8 6 1 5 32 9871 0 2 9 Trp W 0 2 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 9976 1 0 Tyr Y 1 0 3 0 3 0 1 0 4 1 1 0 0 21 0 1 1 2 9945 1 Val V 13 2 1 1 3 2 2 3 3 57 11 1 17 1 3 2 10 0 2 9901
  • 68. Numbers of accepted point mutations (x10) accumulated from closely related sequences. Fractional exchanges result when ancestral sequences are ambiguous: the probabilities are distributed equally among all possibilities. The total number of exchanges tallied was 1,572. Note that 36 exchanges were never observed. The Asp-Glu pair had the largest number of exchanges PAM1: Transition Matrix
  • 69. Principles of Scoring Matrix Construction Second step: Frequencies of Occurence If the properties of amino acids differ and if they occur with different frequencies, all statements we can make about the average properties of sequences will depend on the frequencies of occurence of the individual amino acids. These frequencies of occurence are approximated by the frequencies of observation. They are the number of occurences of a given amino acid divided by the number of amino-acids observed. The sum of all is one.
  • 70. Amino acid frequencies Second step: Frequencies of Occurence 1978 1991 L 0.085 0.091 A 0.087 0.077 G 0.089 0.074 S 0.070 0.069 V 0.065 0.066 E 0.050 0.062 T 0.058 0.059 K 0.081 0.059 I 0.037 0.053 D 0.047 0.052 R 0.041 0.051 P 0.051 0.051 N 0.040 0.043 Q 0.038 0.041 F 0.040 0.040 Y 0.030 0.032 M 0.015 0.024 H 0.034 0.023 C 0.033 0.020 W 0.010 0.014
  • 71. Principles of Scoring Matrix Construction Third step: Relative Mutabilities • To obtain a complete picture of the mutational process, the amino-acids that do not mutate must be taken into account too. • We need to know: what is the chance, on average, that a given amino acid will mutate at all. This is the relative mutability of the amino acid. • It is obtained by multiplying the number of observed changes by the amino acids frequency of occurence.
  • 72. Compute amino acid mutability, mj, i.e., the propability of a given amino acid, j, to be replaced. Aligned A D A Sequences A D B Amino Acids A B D Observed Changes 1 1 0 Frequency of Occurence 3 1 2 (Total Composition) Relative Mutability .33 1 0 Overview
  • 73. Principles of Scoring Matrix Construction 1978 1991 A 100 100 C 20 44 D 106 86 E 102 77 F 41 51 G 49 50 H 66 91 I 96 103 K 56 72 L 40 54 M 94 93 N 134 104 P 56 58 Q 93 84 R 65 83 S 120 117 T 97 107 V 74 98 W 18 25 Y 41 50
  • 74. Principles of Scoring Matrix Construction Fourth step: Mutation Probability Matrix • With these data the probability that an amino acid in row i of the matrix will replace the amino acid in column j can be calculated: it is the mutability of amino acid j, multiplied by the relative pair exchange frequency (the pair exchange frequency for ij divided by the sum of all pair exchange frequencies for amino acid i). Mij= The mutation probability matrix gives the probability, that an amino acid i will replace an amino acid of type j in a given evolutionary interval, in two related sequences ADB ADA A D B A D B i j
  • 75. Principles of Scoring Matrix Construction Fifth step: The Evolutionary Distance • Since the represent the probabilites for amino acids to remain conserved, if we scale all cells of our matrix by a constant factor we can scale the matrix to reflect a specific overall probability of change. We may chose so that the expected number of changes is 1 %, this gives the matrix for the evolutionary distance of 1 PAM.
  • 76. Principles of Scoring Matrix Construction 6. Relatedness Odds • By comparison, the probability that that same event is observed by random chance is simply given by the frequency of occurence of amino acid i • Rij = probability that j replaces i in related proteins ran = probability that j replaces I by chance (eg unrelated proteins) • Pi ran = fi = the frequency of occurance of amino acid i • Pi
  • 77. Principles of Scoring Matrix Construction Last step: the log-odds matrix • Since multiplication is a computationally expensive process, it is preferrable to add the logarithms of the matrix elements. This matrix, the log odds matrix, is the foundation of quantitative sequence comparisons under an evolutionary model. • Since the Dayhoff matrix was taken as the log to base 10, a value of +1 would mean that the corresponding pair has been observed 10 times more frequently than expected by chance. A value of -0.2 would mean that the observed pair was observed 1.6 times less frequently than chance would predict.
  • 79. A B C D E F G H I K L M N P Q R S T V W Y Z 0.4 0.0 -0.4 0.0 0.0 -0.8 0.2 -0.2 -0.2 -0.2 -0.4 -0.2 0.0 0.2 0.0 -0.4 0.2 0.2 0.0 -1.2 -0.6 0.0 A 0.5 -0.9 0.6 0.4 -1.0 0.1 0.3 -0.4 0.1 -0.7 -0.5 0.4 -0.2 0.3 -0.1 0.1 0.0 -0.4 -1.1 -0.6 0.4 B 2.4 -1.0 -1.0 -0.8 -0.6 -0.6 -0.4 -1.0 -1.2 -1.0 -0.8 -0.6 -1.0 -0.8 0.0 -0.4 -0.4 -1.6 0.0 -1.0 C 0.8 0.6 -1.2 0.2 0.2 -0.4 0.0 -0.8 -0.6 0.4 -0.2 0.4 -0.2 0.0 0.0 -0.4 -1.4 -0.8 0.5 D 0.8 -1.0 0.0 0.2 -0.4 0.0 -0.6 -0.4 0.2 -0.2 0.4 -0.2 0.0 0.0 -0.4 -1.4 -0.8 0.6 E 1.8 -1.0 -0.4 0.2 -1.0 0.4 0.0 -0.8 -1.0 -1.0 -0.8 -0.6 -0.6 -0.2 0.0 1.4 -1.0 F 1.0 -0.4 -0.6 -0.4 -0.8 -0.6 0.0 -0.2 -0.2 -0.6 0.2 0.0 -0.2 -1.4 -1.0 -0.1 G 1.2 -0.4 0.0 -0.4 -0.4 0.4 0.0 0.6 0.4 -0.2 -0.2 -0.4 -0.6 0.0 -0.4 H 1.0 -0.4 0.4 0.4 -0.4 -0.4 -0.4 -0.4 -0.2 0.0 0.8 -1.0 -0.2 -0.4 I 1.0 -0.6 0.0 0.2 -0.2 0.2 0.6 0.0 0.0 -0.4 -0.6 -0.8 0.1 K 1.2 0.8 -0.6 -0.6 -0.4 -0.6 -0.6 -0.4 0.4 -0.4 -0.2 -0.5 L 1.2 -0.4 -0.4 -0.2 0.0 -0.4 -0.2 0.4 -0.8 -0.4 -0.3 M 0.4 -0.2 0.2 0.0 0.2 0.0 -0.4 -0.8 -0.4 0.2 N 1.2 0.0 0.0 0.2 0.0 -0.2 -1.2 -1.0 -0.1 P 0.8 0.2 -0.2 -0.2 -0.4 -1.0 -0.8 0.6 Q 1.2 0.0 -0.2 -0.4 0.4 -0.8 0.6 R 0.4 0.2 -0.2 -0.4 -0.6 -0.1 S 0.6 0.0 -1.0 -0.6 -0.1 T 0.8 -1.2 -0.4 -0.4 V 3.4 0.0 -1.2 W 2.0 -0.8 Y 0.6 Z PAM 1 Scoring Matrix
  • 80. • Some of the properties go into the makeup of PAM matrices are - amino acid residue size, shape, local concentrations of electric charge, van der Waals surface, ability to form salt bridges, hydrophobic interactions, and hydrogen bonds. – These patterns are imposed principally by natural selection and only secondarily by the constraints of the genetic code. – Coming up with one’s own matrix of weights based on some logical features may not be very successful because your logical features may have been over-written by other more important considerations. Overview
  • 81. Principles of Scoring Matrix Construction • Two aspects of this process cause the evolutionary distance to be unequal in general to the number of observed differences between the sequences: – First, there is a chance that a certain residue may have mutated, than reverted, hiding the effect of the mutation. – Second, specific residues may have mutated more than once, thus the number of point mutations is likely to be larger than the number of differences between the two sequences..
  • 83. Experiment: pam-simulator.pl • Initialize: – Generate Random protein (1000 aa) • Simulate evolution (eg 250 for PAM250) – Apply PAM1 Transition matrix to each amino acid – Use Weighted Random Selection • Iterate – Measure difference to orginal protein
  • 84. Dayhoff’s PAM1 mutation probability matrix (Transition Matrix) A Ala R Arg N Asn D Asp C Cys Q Gln E Glu G Gly H His I Ile A 9867 2 9 10 3 8 17 21 2 6 R 1 9913 1 0 1 10 0 0 10 3 N 4 1 9822 36 0 4 6 6 21 3 D 6 0 42 9859 0 6 53 6 4 1 C 1 1 0 0 9973 0 0 0 1 1 Q 3 9 4 5 0 9876 27 1 23 1 E 10 0 7 56 0 35 9865 4 2 3 G 21 1 12 11 1 3 7 9935 1 0 H 1 8 18 3 1 20 1 0 9912 0 I 2 2 3 1 2 1 2 0 0 9872
  • 85. Weighted Random Selection • Ala => Xxx (%) A R N D C Q E G H I L K M F P S T W Y V
  • 86. PAM-Simulator PAM-simulator 120 100 80 60 40 20 0 0 50 100 150 200 250 300 PAM %identity
  • 87. PAM-Simulator PAM-Simulator 100 90 80 70 60 50 40 30 20 10 0 0 200 400 600 800 1000 1200 1400 1600 1800 2000 PAM % identity
  • 88. Some PAM values and their corresponding observed distances PAM Value Distance(%) 80 50 100 60 200 75 250 85 <- Twilight zone 300 92 (From Doolittle, 1987, Of URFs and ORFs, University Science Books) •When the PAM distance value between two distantly related proteins nears the value 250 it becomes difficult to tell whether the two proteins are homologous, or that they are two at randomly taken proteins that can be aligned by chance. In that case we speak of the 'twilight zone'. •The relation between the observed percentage in distance of two sequences versus PAM value. Two randomly diverging sequences change in a negatively exponential fashion. After the insertion of gaps to two random sequences, it can be expected that they will be 80 - 90 % dissimilar (from Doolittle, 1987 ).
  • 89. • Creation of a pam series from evolutionary simulations • pam2=pam1^2 • pam3=pam1^3 • And so on… • pam30,60,90,120,250,300 • low pam - closely related sequences – high scores for identity and low scores for substitutions - closer to the identity matrix • high pam - distant sequences – at pam2000 all information is degenerate except for cysteins • pam250 is the most popular and general – one amino acid in five remains unchanged (mutability varies among the amino acids) Overview
  • 91. Overview 250 PAM evolutionary distance A R N D C Q E G H I L K M F P Ala A 13 6 9 9 5 8 9 12 6 8 6 7 7 4 11 Arg R 3 17 4 3 2 5 3 2 6 3 2 9 4 1 4 Asn N 4 4 6 7 2 5 6 4 6 3 2 5 3 2 4 Asp D 5 4 8 11 1 7 10 5 6 3 2 5 3 1 4 Cys C 2 1 1 1 52 1 1 2 2 2 1 1 1 1 2 Gln Q 3 5 5 6 1 10 7 3 7 2 3 5 3 1 4 Glu E 5 4 7 11 1 9 12 5 6 3 2 5 3 1 4 Gly G 12 5 10 10 4 7 9 27 5 5 4 6 5 3 8 His H 2 5 5 4 2 7 4 2 15 2 2 3 2 2 3 Ile I 3 2 2 2 2 2 2 2 2 10 6 2 6 5 2 Leu L 6 4 4 3 2 6 4 3 5 15 34 4 20 13 5 Lys K 6 18 10 8 2 10 8 5 8 5 4 24 9 2 6 Met M 1 1 1 1 0 1 1 1 1 2 3 2 6 2 1 Phe F 2 1 2 1 1 1 1 1 3 5 6 1 4 32 1 Pro P 7 5 5 4 3 5 4 5 5 3 3 4 3 2 20 Ser S 9 6 8 7 7 6 7 9 6 5 4 7 5 3 9 Thr T 8 5 6 6 4 5 5 6 4 6 4 6 5 3 6 Trp W 0 2 0 0 0 0 0 0 1 0 1 0 0 1 0 Tyr Y 1 1 2 1 3 1 1 1 3 2 2 1 2 15 1 Val V 7 4 4 4 4 4 4 4 5 4 15 10 4 10 5 [column on left represents the replacement amino acid] Mutation probability matrix for the evolutionary distance of 250 PAMs. To simplify the appearance, the elements are shown multiplied by 100. In comparing two sequences of average amino acid frequency at this evolutionary distance, there is a 13% probability that a position containing Ala in the first sequence will contain Ala in the second. There is a 3% chance that it will contain Arg, and so forth.
  • 92. A brief history of time (BYA) Origin of life Origin of eukaryotes insects Fungi/animal Plant/animal Earliest fossils 4 3 2 1 0 BYA
  • 93. Margaret Dayhoff’s 34 protein superfamilies Protein PAMs per 100 million years Ig kappa chain 37 Kappa casein 33 Lactalbumin 27 Hemoglobin a 12 Myoglobin 8.9 Insulin 4.4 Histone H4 0.10 Ubiquitin 0.00
  • 94.  Many sequences depart from average composition.  Rare replacements were observed too infrequently to resolve relative probabilities accurately (for 36 pairs no replacements were observed!).  Errors in 1PAM are magnified in the extrapolation to 250PAM.  Distantly related sequences usually have islands (blocks) of conserved residues. This implies that replacement is not equally probable over entire sequence. Sources of error
  • 95. • Simple identity, which scores only identical amino acids as a match. • Genetic code changes, which scores the minimum number of nucieotide changes to change a codon for one amino acid into a codon for the other. • Chemical similarity of amino acid side chains, which scores as a match two amino acids which have a similar side chain, such as hydrophobic, charged and polar amino acid groups. • The Dayhoff percent accepted mutation (PAM) family of matrices, which scores amino acid pairs on the basis of the expected frequency of substitution of one amino acid for the other during protein evolution. • The blocks substitution matrix (BLOSUM) amino acid substitution tables, which scores amino acid pairs based on the frequency of amino acid substitutions in aligned sequence motifs called blocks which are found in protein families Overview
  • 96. BLOSUM: Blocks Substitution Matrix • Henikoff & Henikoff (Henikoff, S. & Henikoff J.G. (1992) PNAS 89:10915- 10919) • asking about the relatedness of distantly related amino acid sequences ? • They use blocks of sequence fragments from different protein families which can be aligned without the introduction of gaps. These sequence blocks correspond to the more highly conserved regions.
  • 97. BLOSUM (BLOck – SUM) scoring S = 3 sequences W = 6 aa N= (W*S*(S-1))/2 = 18 pairs DDNAAV DNAVDD NNVAVV Block = ungapped alignent Eg. Amino Acids D N V A a b c d e f 1 2 3
  • 98. A. Observed pairs a b c d e f DDNAAV DNAVDD NNVAVV 1 2 3 D N A V D N A V 1 4 1 3 1 1 1 1 4 1 f fij D N A V D N A V .056 .222 .056 .167 .056 .056 .056 .056 .222 .056 gij /18 Relative frequency table Probability of obtaining a pair if randomly choosing pairs from block
  • 99. B. Expected pairs A DDDDD NNNN AAAA VVVVV DDNAAV DNAVDD NNVAVV Pi 5/18 4/18 4/18 5/18 P{Draw DN pair}= P{Draw D, then N or Draw M, then D} P{Draw DN pair}= PDPN + PNPD = 2 * (5/18)*(4/18) = .123 D N A V D N A V .077 .123 .154 .123 .049 .123 .099 .049 .123 .049 eRandom rel. frequency table ij Probability of obtaining a pair of each amino acid drawn independently from block
  • 100. C. Summary (A/B) sij = log2 gij/eij (sij) is basic BLOSUM score matrix Notes: • Observed pairs in blocks contain information about relationships at all levels of evolutionary distance simultaneously (Cf: Dayhoffs’s close relationships) • Actual algorithm generates observed + expected pair distributions by accumalution over a set of approx. 2000 ungapped blocks of varrying with (w) + depth (s)
  • 101. • blosum30,35,40,45,50,55,60,62,65,70,75,80,85,90 • transition frequencies observed directly by identifying blocks that are at least – 45% identical (BLOSUM45) – 50% identical (BLOSUM50) – 62% identical (BLOSUM62) etc. • No extrapolation made • High blosum - closely related sequences • Low blosum - distant sequences • blosum45  pam250 • blosum62  pam160 • blosum62 is the most popular matrix The BLOSUM Series
  • 103. • Church of the Flying Spaghetti Monster • http://www.venganza.org/about/open-letter
  • 104. • Which matrix should I use? – Matrices derived from observed substitution data (e.g. the Dayhoff or BLOSUM matrices) are superior to identity, genetic code or physical property matrices. – Schwartz and Dayhoff recommended a mutation data matrix for the distance of 250 PAMs as a result of a study using a dynamic programming procedure to compare a variety of proteins known to be distantly related. • The 250 PAM matrix was selected since in Monte Carlo studies matrices reflecting this evolutionary distance gave a consistently higher significance score than other matrices in the range 0.750 PAM. The matrix also gave better scores when compared to the genetic code matrix and identity scoring. Overview
  • 105. Which matrix should I use? • When comparing sequences that were not known in advance to be related, for example when database scanning: – default scoring matrix used is the BLOSUM62 matrix – if one is restricted to using only PAM scoring matrices, then the PAM120 is recommended for general protein similarity searches • When using a local alignment method, Altschul suggests that three matrices should ideally be used: PAM40, PAM120 and PAM250, the lower PAM matrices will tend to find short alignments of highly similar sequences, while higher PAM matrices will find longer, weaker local alignments.
  • 106. Rat versus mouse RBP Rat versus bacterial lipocalin
  • 107. – Henikoff and Henikoff have compared the BLOSUM matrices to PAM by evaluating how effectively the matrices can detect known members of a protein family from a database when searching with the ungapped local alignment program BLAST. They conclude that overall the BLOSUM 62 matrix is the most effective. • However, all the substitution matrices investigated perform better than BLOSUM 62 for a proportion of the families. This suggests that no single matrix is the complete answer for all sequence comparisons. • It is probably best to compliment the BLOSUM 62 matrix with comparisons using 250 PAMS, and Overington structurally derived matrices. – It seems likely that as more protein three dimensional structures are determined, substitution tables derived from structure comparison will give the most reliable data. Overview
  • 108. Overview • Introduction – Short recap on databases – Definitions • Scoring Matrices – Theoretical – Empirial • PAM (pam-simulator.pl) • BLOSUM • Pairwise alignment – Dot-plots (dotplot-simulator.pl) Overview
  • 109. Dotplots • What is it ? – Graphical representation using two orthogonal axes and “dots” for regions of similarity. – In a bioinformatics context two sequence are used on the axes and dots are plotted when a given treshold is met in a given window. • Dot-plotting is the best way to see all of the structures in common between two sequences or to visualize all of the repeated or inverted repeated structures in one sequence
  • 110. Dot Plot References Gibbs, A. J. & McIntyre, G. A. (1970). The diagram method for comparing sequences. its use with amino acid and nucleotide sequences. Eur. J. Biochem. 16, 1-11. Staden, R. (1982). An interactive graphics program for comparing and aligning nucleic-acid and amino-acid sequences. Nucl. Acid. Res. 10 (9), 2951-2961.
  • 111. Visual Alignments (Dot Plots) • Matrix – Rows: Characters in one sequence – Columns: Characters in second sequence • Filling – Loop through each row; if character in row, col match, fill in the cell – Continue until all cells have been examined
  • 112. Dotplot-simulator.pl print " $seq1n"; for(my $teller=0;$teller<=$seq2_length;$teller++){ print substr($seq2,$teller,1); $w2=substr($seq2,$teller,$window); for(my $teller2=0;$teller2<=$seq_length;$teller2++){ $w1=substr($seq1,$teller2,$window); if($w1 eq $w2){print "*";}else{print " ";} } print"n"; }
  • 113. Overview Window size = 1, stringency 100%
  • 114. Noise in Dot Plots • Nucleic Acids (DNA, RNA) – 1 out of 4 bases matches at random • Stringency – Window size is considered – Percentage of bases matching in the window is set as threshold
  • 115. Reduction of Dot Plot Noise Self alignment of ACCTGAGCTCACCTGAGTTA
  • 116. Dotplot-simulator.pl Example: ZK822 Genomic and cDNA Gene prediction: How many exons ? Confirm donor and aceptor sites ? Remember to check the reverse complement !
  • 117. Chromosome Y self comparison
  • 118. • Regions of similarity appear as diagonal runs of dots • Reverse diagonals (perpendicular to diagonal) indicate inversions • Reverse diagonals crossing diagonals (Xs) indicate palindromes • A gap is introduced by each vertical or horizontal skip Overview
  • 119. • Window size changes with goal of analysis – size of average exon – size of average protein structural element – size of gene promoter – size of enzyme active site Overview
  • 120. Rules of thumb  Don't get too many points, about 3- 5 times the length of the sequence is about right (1-2%)  Window size about 20 for distant proteins 12 for nucleic acid  Check sequence vs. itself  Check sequence vs. sequence  Anticipate results (e.g. “in-house” sequence vs genomic, question) Overview
  • 121. Available Dot Plot Programs Dotlet (Java Applet) http://www.isrec.isb-sib. ch/java/dotlet/Dotlet. html
  • 122. Available Dot Plot Programs Dotter (http://www.cgr.ki.se/cgr/groups/sonnhammer/Dotter.html)
  • 123. Available Dot Plot Programs EMBOSS DotMatcher, DotPath,DotUp
  • 124. Weblems • W3.1: Why does 2 PAM, i.e. 1 PAM multiplied with itself, not correspond to exactly 2% of the amino acids having mutated, but a little less than 2% ? Or, in other words, why does a 250 PAM matrix not correspond to 250% accepted mutations ? • W3.2: Is it biologically plausible that the C-C and W-W entries in the scoring matrices are the most prominent ? Which entries (or groups of entries) are the least prominent ? • W3.3: What is OMIM ? How many entries are there ? What percentage of OMIM listed diseases has no known (gene) cause ? • W3.4: Pick one disease mapped to chromosome Y from OMIM where only a mapping region is known. How many candidate genes can you find in the locus using ENSEMBL ? Can you link ontology terms for the candidates to the disease phenotype ?